KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_0366Help
Entry
MSMEI_0366        CDS       T02191                                 

Gene name
fadA2
Definition
(GenBank) putative acetyl-COA acyltransferase Fada2 (3-ketoacyl-COA thiolase) (beta-ketothiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00071  Fatty acid degradation
msg00280  Valine, leucine and isoleucine degradation
msg00310  Lysine degradation
msg00362  Benzoate degradation
msg00380  Tryptophan metabolism
msg00620  Pyruvate metabolism
msg00630  Glyoxylate and dicarboxylate metabolism
msg00640  Propanoate metabolism
msg00650  Butanoate metabolism
msg00900  Terpenoid backbone biosynthesis
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
msg01212  Fatty acid metabolism
msg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_0366 (fadA2)
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEI_0366 (fadA2)
   00640 Propanoate metabolism
    MSMEI_0366 (fadA2)
   00650 Butanoate metabolism
    MSMEI_0366 (fadA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_0366 (fadA2)
   00072 Synthesis and degradation of ketone bodies
    MSMEI_0366 (fadA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_0366 (fadA2)
   00310 Lysine degradation
    MSMEI_0366 (fadA2)
   00380 Tryptophan metabolism
    MSMEI_0366 (fadA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSMEI_0366 (fadA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_0366 (fadA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSMEI_0366 (fadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msg04147]
    MSMEI_0366 (fadA2)
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MSMEI_0366 (fadA2)
Exosome [BR:msg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEI_0366 (fadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AFP36847
UniProt: I7FW74
Position
417966..419264
Genome map
AA seq 432 aa AA seqDB search
MANESRRRVAVLGGNRIPFARSDGAYANASNQDMFTAALGGLIDRFNLAGEQLGAVIGGA
VLKHSRDFNLMRECVLGSALSPYTPAFDIQQACGTGLQAAIAAADGIAAGRYESAAAGGV
DTASDAPIAFGNDLRRVLLGLRRAKSNVDRLKLVGKLPASLGVEIPVNSEPRTGMSMGEH
AAVTAKAMGIKRVEQDELAAASHRNMAAAYDAGFFDDLVTPFLGVYRDNNLRADSSVEKL
AKLKPVFGVKAGDATMTAGNSTPLTDGASVALLAGEDWAQARGLEPLAYFVDAETAAVDY
VNGPDGLLMAPTYAVPRLLARNNLTLQDFDFYEIHEAFASVVLAHLQAWESDEYCKERLG
LDKALGSIDRTKLNVNGSSLAAGHPFAATGGRIVAQLAKQLAEKKKSTGRPVRGLISICA
AGGQGVAAILEA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgaatcgagacgccgtgtcgccgtcctcggcggcaaccggattccgttcgcg
cgatccgacggtgcgtacgccaacgcctccaaccaggacatgttcaccgcggccctcggc
gggttgatcgaccggttcaacctggccggcgagcagctcggcgcggtgatcggcggggcc
gtgctcaagcacagccgcgacttcaacctcatgcgcgagtgcgtgctgggcagcgcgctg
tcgccctacacccccgccttcgacatccagcaggcctgcggcacgggtctgcaggccgcc
atcgccgcagccgacggcatcgccgcgggtcgctacgagtccgctgccgccggtggtgtg
gacaccgcgtcggacgcgccgatcgcgttcggcaacgatctgcgccgcgtgctgctcggc
ctgcggagggcgaagtcgaacgtcgaccgtctcaagctcgtcggcaagctgccggcgtcg
ctcggcgtcgagatccccgtcaacagcgaaccgcgcaccggcatgtcgatgggcgagcac
gcggcagtgaccgccaaggcgatgggcatcaagcgcgtcgagcaggacgaactcgcggcg
gccagccaccgcaacatggctgcggcgtatgacgccgggttcttcgacgatctggtgacg
ccgttcctcggcgtctaccgcgacaacaacctgcgcgccgattcgagtgtcgagaagctc
gcgaagctcaagccggtgttcggcgtgaaggccggcgacgcgacgatgacggccggcaac
tcgacaccgctgaccgacggcgcctcggtggctctgctggccggcgaggactgggcgcag
gcccgcggcctggagccgctcgcgtacttcgtcgacgccgaaaccgcggccgtcgactac
gtcaacgggcccgacgggctgctgatggctcccacctacgcggtaccgcgcctgctcgcg
cgcaacaacctcacgctgcaggacttcgacttctacgagatccacgaggcgttcgcctcg
gtggtcctcgcgcacctgcaggcgtgggagtccgacgagtactgcaaggagcggctgggc
ctcgacaaggcgctcggctcgatcgaccgcacgaagctcaacgtcaacggctcgtcgctc
gcggccgggcacccgttcgcggcgacgggcggccggatcgtggcgcaactggccaagcag
ctcgcggagaagaagaaatccaccggccggccggtgcgcggtctgatctcgatctgtgcg
gcgggcggccagggcgtcgcggcgatcctggaggcctga

DBGET integrated database retrieval system