KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1324Help
Entry
MSMEI_1324        CDS       T02191                                 

Definition
(GenBank) Sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00052  Galactose metabolism
msg00500  Starch and sucrose metabolism
msg00520  Amino sugar and nucleotide sugar metabolism
msg00521  Streptomycin biosynthesis
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Module
msg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
msg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_1324
   00052 Galactose metabolism
    MSMEI_1324
   00500 Starch and sucrose metabolism
    MSMEI_1324
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEI_1324
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSMEI_1324
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MSMEI_1324
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSMEI_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: AFP37797
UniProt: I7FY03
Position
1458933..1459838
Genome map
AA seq 301 aa AA seqDB search
MTLTLALDIGGTKIAAGLVDDDGALVHQAQLPTPDGDGELIWNVVDELVTGALRVADGAV
DGVGIAAAGPIDLPGGTISPINIVEWQRFPIVDRVAAATGLPVRLGGDGLCMALGEHWRG
AGRGAQFLLGMVVSTGVGGGLVLDGAPYDGRTGNAGHAGHVIVELEDGDLCTCGGHGCVE
TVASGPNMTRWARRQGWQAPADADAKELADAANAGDAVALAAYRRGARAVAAMIASVGAV
CDLDLVVIGGGVAKSGALLFDPIREALKNYAGLDFLRTLQVVPAELGGDAGLIGAAALAR
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaccctggccctggacatcggtggcaccaagatcgctgccggcctggtcgac
gacgacggcgctctggtgcatcaggctcagctgcccacacccgacggcgacggcgaactg
atctggaacgtcgtcgacgaacttgtcaccggggccctgcgggtggccgacggcgcggtg
gatggggtcggcatcgccgcggccgggcctatcgacctgccaggcggaaccatcagcccc
atcaacatcgtcgagtggcaacggtttccgatcgtcgatcgcgtggctgccgcgaccggg
cttccggtgcggctcggcggtgacggactgtgcatggcgctcggcgagcattggcgtggt
gcgggccggggtgcgcagttcctgctgggcatggtggtgtcgaccggcgtcgggggaggg
ctcgtgctcgacggggcgccgtacgacgggcggaccggcaacgcaggacacgcggggcac
gtcatcgtcgaactcgaagacggagacctgtgcacgtgcggtgggcacggctgcgtcgag
accgtcgcgtccggacccaacatgacgcggtgggcgcgcaggcagggttggcaggcgccg
gccgatgccgacgccaaggagctcgccgacgcggccaacgccggggatgccgtcgcgctc
gcggcgtaccggcgcggtgcacgcgcggttgcggcgatgatcgcgtcggtgggcgcggtg
tgcgatctggatctggtggtgatcggcggcggggtcgcgaagtcgggggcgctgctgttc
gacccgatccgcgaggcactgaagaactacgccggcctggatttcctgcggaccctgcag
gtggtgcctgccgaactcggcggagatgccggcctgatcggggcggcggcgctggcccgg
gcgtga

DBGET integrated database retrieval system