KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1565Help
Entry
MSMEI_1565        CDS       T02191                                 

Gene name
choD
Definition
(GenBank) Cholesterol oxidase ChoD
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00984  Steroid degradation
msg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MSMEI_1565 (choD)
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MSMEI_1565 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Pyr_redox Fer4_10 Fer4_21 Fer4 HI0933_like Fer4_4
Motif
Other DBs
NCBI-ProteinID: AFP38038
UniProt: I7FGQ8
Position
1692017..1693753
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDEEFAKTSWQLRKFLWAPKL
GCYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPFFADRQWAGITDWRAELTPHY
DQAQRMLGVVTNPTFTDADRVVKEVADDMGVGDTFVQTPVGVFFGPDGEKTPGKTVPDPY
FGGVGPDRTGCIECGSCMTGCRYGAKNTLLKNYLGLAERGGAEVHPLRTVAGFEQLPDGT
WRVDTVRTGRWARKDKRSFTATHVVLAAGTWGTQRLLFKMRDTGKLPKLSSRLGVLTRTN
SESIVGAGRYEVTPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGDG
PDGAGIPRWKQLLRNAAEDPRGTLRLLNVHRWSERTLIALVMQHLDNSITTYTKRNRLGI
RRYLSKQGHGAPNPTWIPVGNEVTRRIAKKIDGVAGGTWGELFNIPLTAHFLGGAAIGDS
PETGVIDPYQRVYNYPTLHVMDGAAISANLGVNPSLSITAQAERATSLWPNKGEQDQRPA
QGEPYRRLAPIAPVRPVVPADAPGALRRLPIEPVSSAG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgactacgacgtcttggtgatcggttccggattcggcggcagcgtgagtgcg
ctgcggctcaccgaaaagggctaccgggtgggtgtgctcgaggcgggccgccgcttctcc
gacgaggagttcgcgaagacctcgtggcagctgcgcaaattcctgtgggcgcccaagctc
gggtgctacggcatccagcgcatccatctgctgcgcaacgtgatgatcctggccggcgcc
ggtgtcggcggcggatcgctcaactacgccaacacgctgtacgtgccgccggagccgttc
ttcgccgaccggcagtgggccggcatcaccgactggcgcgccgaactcacgccgcactac
gaccaggcgcagcgcatgctgggcgtggtcaccaacccgaccttcaccgacgccgaccgc
gtggtgaaggaggtcgccgacgacatgggcgtcggggacacgttcgtgcagacgccggtc
ggggtgttcttcggtcccgacggcgagaagacgcccggcaagaccgtgccggacccgtac
ttcggtggcgtgggcccggaccgcaccgggtgcatcgagtgcggatcgtgcatgaccggt
tgccgctacggcgccaagaacacgctgctcaagaactacctggggctcgcagaacggggc
ggtgccgaggtgcatccgctgcggacggtggccgggttcgagcaactgcccgacggcacc
tggcgcgtcgacaccgtgcgcaccggccggtgggcacgtaaggacaagcgctcgttcacc
gcgacgcacgtggtgctggccgcgggcacctggggtacgcagcggctgctgttcaagatg
cgcgacaccggcaagctgcccaagctgtcgtcacggcttggcgtgctgacgcgcaccaat
tccgaatcgatcgtcggggccgggcgctacgaggtcacgccggatctggacctcacccac
ggcgtggcgatcacgtcgtcgatccacccgacgcccgacacccacatcgaacccgtgcgc
tacggcaagggctccaacgcgatggggctgctgcagacgctgatgaccgacggcgacgga
cccgacggcgcgggaatcccgcgctggaaacagctgctgcgcaacgccgccgaggacccg
cgtggcacactgcgcctgctcaacgtgcaccgctggagcgagcgcacgctcatcgcgctg
gtcatgcagcacctggacaactcgatcaccacctacaccaaacgcaaccgcctgggcatc
cggcgctacctgagcaagcaggggcacggtgcgcccaaccccacctggatcccggtgggc
aacgaggtgacccggcggatcgccaagaagatcgacggcgtcgcgggcggcacgtgggga
gagctgttcaacatcccgctgaccgcgcacttcctgggcggcgcggccatcggcgacagc
ccggaaaccggcgtcatcgacccctaccagcgcgtctacaactatccgacgctgcacgtc
atggacggcgcggcgatctcggccaacctcggggtgaacccgtcgctgtccatcacggca
caggccgagcgggcgacgtcgctgtggcccaacaagggcgagcaggatcagcggcccgcc
cagggcgagccgtaccggcggctcgcgccgatcgcgcccgtccgtcccgtggtgcccgcc
gacgctccaggagcgctgcgccggctgccgatcgaacccgtgtcgtcggcggggtag

DBGET integrated database retrieval system