KEGG   Mycobacterium smegmatis MC2 155: MSMEI_1631Help
Entry
MSMEI_1631        CDS       T02191                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00020  Citrate cycle (TCA cycle)
msg00190  Oxidative phosphorylation
msg00650  Butanoate metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Module
msg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
msg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEI_1631 (sdhD)
   00650 Butanoate metabolism
    MSMEI_1631 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MSMEI_1631 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFP38103
UniProt: I7FGY0
Position
complement(1767291..1767761)
Genome map
AA seq 156 aa AA seqDB search
MSAPGAGESRLGRPAPVMEREHDRPAALDHPRAPRKPRGIPYFEKYAWLFMRFSGIALVF
LALGHLFIMLMWQDGVYRIDFNYVAERWASPFWQIWDMALLWLAMIHGANGMRTIIGDYA
RKNVTKFWLNSLLLLATGFTLVLGSYVLVTFDANIS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccaggggcaggcgaatcccgcctggggcgcccggcgcccgtgatggaacgt
gagcacgatcgcccggccgcgctcgatcacccgcgcgcgccgcgcaagcctcgcggcatc
ccgtacttcgagaagtacgcctggctgttcatgcggttctccggcattgcgctggtgttc
ctggcgctcggccacctgttcatcatgctgatgtggcaggacggcgtgtaccggatcgat
ttcaactacgtcgcagagcgctgggcctcgccgttctggcagatctgggacatggccctg
ctctggttggcaatgatccacggcgccaacggcatgcgcaccatcatcggtgactacgcc
cgcaagaacgtcacgaagttctggctgaactcgcttctgctgctggcgaccggtttcacg
ttggtgctgggcagctacgtactggtcaccttcgacgcgaatatttcataa

DBGET integrated database retrieval system