KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_1856Help
Entry
MSMEI_1856        CDS       T02191                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00071  Fatty acid degradation
msg00072  Synthesis and degradation of ketone bodies
msg00280  Valine, leucine and isoleucine degradation
msg00310  Lysine degradation
msg00362  Benzoate degradation
msg00380  Tryptophan metabolism
msg00620  Pyruvate metabolism
msg00630  Glyoxylate and dicarboxylate metabolism
msg00640  Propanoate metabolism
msg00650  Butanoate metabolism
msg00900  Terpenoid backbone biosynthesis
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
msg01212  Fatty acid metabolism
msg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_1856
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEI_1856
   00640 Propanoate metabolism
    MSMEI_1856
   00650 Butanoate metabolism
    MSMEI_1856
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_1856
   00072 Synthesis and degradation of ketone bodies
    MSMEI_1856
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_1856
   00310 Lysine degradation
    MSMEI_1856
   00380 Tryptophan metabolism
    MSMEI_1856
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSMEI_1856
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_1856
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSMEI_1856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msg04147]
    MSMEI_1856
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MSMEI_1856
Exosome [BR:msg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEI_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFP38328
UniProt: I7FHP3
Position
1977123..1978355
Genome map
AA seq 410 aa AA seqDB search
MASDSSASQVVICNPLRTPVGRMGGVLAALTAADLATSTLRELATRTGLGEGDIDDVVLG
HGYPSGEAPAIGRIAALDAGLGTAVPGLQLDRRCGSGLQAVLYAAGQVATGAAGVVVAGG
AESMSNVEHYALGLRTGVRQGGVALHDRLDRARETAGGTSHPIAGGMIETAENLRREYGI
SRAEQDELAVRSHQRAVAAHDAGRFADELVPVTVPGKRGRPGTVVDRDEHPRADIDVETL
SALRPIRGKVDAEATVTAGNASGQNDGAAMCVVTTREEAEKRGLTPMLALKSWAVTGCAP
EKMGIGPVAASDAALQRAGITLDEVDLIELNEAFAAQVLAVLAEWKVDPLDERLNPNGSG
ISLGHPIGATGARILATAAHEALRRDARYVLETMCIGGGQGLAAVFEAVR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgattcgtccgcatcccaggtggtcatctgcaatccgctccgtaccccggtc
gggcggatgggcggtgtgctcgccgcactgaccgccgccgacctcgcgacgtcgacgctg
cgcgaactcgcgacgcggaccggcctcggtgaaggggacatcgacgacgtcgtcctcggc
cacggctacccgagcggcgaggcaccggccatcgggcgcatcgccgcgctcgacgccggt
ctcggcaccgctgtgcccggcctgcagctcgaccgccgctgcggatcgggtctgcaggcc
gtgctgtacgccgccgggcaggtcgccacgggagcggccggtgtggtcgtggccggcggc
gccgagtcgatgtcgaacgtcgagcactacgccctcggcctgcgcaccggtgtccgccag
ggcggtgtggcgctgcacgaccggctcgaccgggcacgtgaaaccgcaggtggcacaagc
catcccatcgccggaggcatgatcgagaccgccgagaacctgcgccgcgagtacggcatc
agccgcgccgaacaggacgaactcgccgtgcggtcgcatcagcgtgcggtcgccgcgcac
gacgcgggccgcttcgccgacgaactcgtcccggtcacggtccccggcaagcggggcaga
cccggcaccgtcgtcgaccgcgacgagcatccccgcgccgacatcgacgtcgagactttg
agcgcgctgcggccgatccgaggcaaggtcgacgccgaggccaccgtcaccgcaggcaac
gcctccgggcagaacgacggtgcggccatgtgcgtcgtgaccacccgcgaagaagccgaa
aagcgcgggctcacacccatgttggcgctcaagtcgtgggcggtcaccgggtgtgcgccc
gagaagatgggcatcggacccgtcgcggccagtgacgcggcgttgcagcgcgctggaatc
accctcgacgaggtggatctcatcgaactcaacgaggcattcgccgcccaggtgctcgct
gtgctcgccgaatggaaggtcgacccgctcgacgaacggctcaaccccaacggatccggc
atctcgctgggccacccgatcggtgccaccggtgcgcggatcctggcgaccgcggcccac
gaggcgctgcggcgcgacgcccgctacgtgctggagaccatgtgcatcggcggcggccag
ggcctcgcggcggtgttcgaggccgtccgatga

DBGET integrated database retrieval system