KEGG   Mycobacterium smegmatis MC2 155: MSMEI_2691Help
Entry
MSMEI_2691        CDS       T02191                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase PpgK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00010  Glycolysis / Gluconeogenesis
msg00520  Amino sugar and nucleotide sugar metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Module
msg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
msg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEI_2691 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MSMEI_2691 (ppgK)
Enzymes [BR:msg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MSMEI_2691 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFP39159
UniProt: I7G9D5
Position
complement(2829435..2830253)
Genome map
AA seq 272 aa AA seqDB search
MTAQDQPTADPTTAGTTGRRGFGVDVGGSGVKGGIVDLDTGKLVGERFKLDTPQPATPEA
VAKTVAAVVREFGWTGKLGVTYPGVVTGGIVRTAANVDKGWIGVNAVETISKALDGQEVT
VLNDADAAGLAEERFGAGKDNSGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKEA
EHRAASSVKERKDWSYSRWSEEVTKVLITIENAIWPDLFIAGGGISRKADKWIPMLKNRT
PVVAAALQNTAGIVGAAMASVVDVQATGGQQL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaagatcagcccacggccgatccgacgaccgcagggaccaccggccgccga
ggattcggcgtggacgtcggcggcagcggggtcaagggcggcatcgtcgacctcgacacc
ggcaaactcgtcggtgagcggttcaagctcgacacgccgcagcccgcgactcctgaggcg
gtcgccaagaccgtcgcggccgtggtgcgcgagttcggctggaccgggaaactcggcgtg
acctatcccggcgtggtgaccggcggcatcgtccgcaccgccgccaacgtcgacaagggg
tggatcggcgtgaacgccgtcgagaccatcagcaaggcgctcgacggtcaggaggtgacc
gtcctcaacgacgccgacgccgcaggcctggccgaggaacggttcggcgcgggcaaggac
aacagcggcgtgatcgtgctgctcacattcggcaccggcatcggatcggccgtgatccac
aacggtgtcctgttgcccaacaccgaatttggccacctcgaggtcggcggcaaggaagcc
gagcaccgcgccgcctcgtcggtcaaggaacgcaaggactggagctattcgcggtggagc
gaggaggtcaccaaggtcctgatcacgatcgagaacgcgatctggcccgatctgttcatc
gcgggcggcggtatcagccgcaaggccgacaagtggatcccgatgctgaagaaccggacg
cccgtcgtcgccgcggccctgcagaacacggcgggcatcgtcggcgcggcgatggcgtcg
gtggtcgacgtccaggccaccggcgggcagcaactgtga

DBGET integrated database retrieval system