KEGG   Mycobacterium smegmatis MC2 155: MSMEI_3555Help
Entry
MSMEI_3555        CDS       T02191                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00620  Pyruvate metabolism
msg00630  Glyoxylate and dicarboxylate metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_3555 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEI_3555 (glcB)
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MSMEI_3555 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DivIC
Motif
Other DBs
NCBI-ProteinID: AFP40018
UniProt: I7FMS9
Position
3704864..3707062
Genome map
AA seq 732 aa AA seqDB search
MSDRVAVGNLRVAKVLHDFITNEALPGTGVDPDSFWSGVDKVVSDLTPKNQELLARRDEL
QAQIDKWHRSHVLEPVDPVAYKQFLTDIGYLLPEPEDFTITTAGVDDEITTTAGPQLVVP
ILNARFALNAANARWGSLYDALYGTDVISEEDGAEKGTGYNKIRGDKVIAYARGFLDEVV
PLAEGSWSEATGLKIDDGALEVALGDDKVTGLSVPEAFVGYTGELGEPQWSVLLRNHGLH
IEILIDPSSPVGSTDSAGIKDVVLESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNRGD
LTEEVTKGDKTFTRVLNDDRVFKTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDADGNE
IPEGIQDALFTSLIAMHGLKAGDQNGPLTNSRTGSIYIVKPKMHGPDEVAFTCELFSRVE
DVLGLPANTLKVGIMDEERRTSVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPM
VRKGTMKSQPWILAYEDANVDVGLAAGFSGKAQIGKGMWAMTDLMADMVEQKIGQPKAGA
TTAWVPSPTAATLHAMHYHQVDVFAVQSELAGKKRGKLEDLLTIPLADSSLTWSPEEIHE
EVDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEE
DVKTSLRRMAAVVDEQNAGDPAYLPMAPNPDASIAFAAAQELILSGTQQPNGYTEPILHR
RRREFKARAAAQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgcgttgcagttggaaacctgcgtgtggccaaggtgctgcacgacttcatc
accaacgaggcgctgccgggtactggcgtagaccccgacagcttctggtcgggtgtcgac
aaggtggtctccgacctgaccccgaagaaccaggaactgctggcgcgccgcgacgaactg
caggcgcagatcgacaagtggcaccgctcgcacgtgctcgagccggtggacccggtcgcc
tacaagcagttcctcaccgacatcggctacctgctgccggagcccgaggacttcaccatc
accaccgcaggtgtcgacgacgagatcaccaccaccgcgggcccgcagctcgtggtgccg
atcctcaacgcgcgcttcgccctcaacgccgcaaacgcacgctggggttcgctgtacgac
gcgctgtacggcaccgacgtcatctccgaggaggacggcgccgagaagggcacggggtac
aacaagatccgtggcgacaaggtgatcgcctacgcgcgcggattcctcgacgaggtcgtg
ccgctggccgagggttcgtggagcgaggccaccggtctgaaaatcgacgacggcgcactg
gaagtcgcgctcggcgacgacaaggtcaccggactctcggtgcccgaggcgttcgtcggc
tacaccggcgaactcggcgagccgcagtggtcggtgctgctgcgcaatcacgggctgcac
atcgagatcctcatcgacccgtcctcgcccgtcggctcgaccgactccgcaggcatcaag
gacgtcgtgctggagtccgcggtcaccacgatcatggacttcgaggattcggtcgccgcg
gtcgacgccgacgacaaggtgctcggctaccgcaactggctgggcctgaaccgcggtgac
ctcaccgaagaggtcaccaagggcgacaagaccttcacgcgtgtcctcaacgacgaccgc
gtgttcaagacccccgacggcgaaggtgagctgaccctgcccggtcgcagcctgctgttc
gtccgcaacgtcggccacctgatgaccaacgacgcgatcgtcgacgccgatgggaacgag
atccccgaaggcatccaggacgcgttgttcaccagcctgatcgcgatgcacggcctcaag
gccggcgaccagaacggcccgctgaccaacagccgcacgggttcgatctacatcgtcaaa
cccaagatgcacggccccgacgaggtcgccttcacctgtgagctgttcagccgcgtcgag
gacgtgctcggcctgcccgccaacaccctcaaggtcggcatcatggatgaggagcggcgc
acctcggtcaacctcaaggcctgcatcaaggccgccgccgaccgcgtggtgttcatcaac
accggattcctcgaccgcaccggcgacgagatccacacctcgatggaagccgggcccatg
gtgcgcaagggcaccatgaagagccagccctggatcctggcctacgaggacgccaacgtc
gacgtcggtctggccgccgggttctccggcaaggcccagatcggcaagggcatgtgggcc
atgaccgacctgatggccgacatggtcgagcagaagatcggccagcccaaggccggcgcc
accaccgcgtgggtgccctccccgactgccgccacgctgcacgcgatgcactaccaccag
gtcgacgtgttcgcggtgcagtccgaactcgcgggcaagaagcgcggcaagctcgaagac
ctgctgaccatcccgctggccgactcgtcgctgacgtggtcgcccgaggagatccacgaa
gaggtcgacaacaactgccagtcgatcctgggctacgtggtgcgctggatcgacgccggt
gtcggctgttcgaaggtccccgacatccacgacgtcgcactcatggaggaccgcgcgacg
ctgcggatctccagccagctgctggccaactggctgcgccacggtgtgatcaccgaggag
gacgtcaagaccagcctgcggcgcatggcggccgtggtcgacgagcagaacgcgggcgat
ccggcgtacctgccgatggcgccgaaccccgacgccagcatcgccttcgccgccgcgcag
gagctgatcctgtcgggcacacagcaacccaacggctacaccgaaccgatcctgcaccgg
cgccgccgcgagttcaaagcccgcgccgctgcgcagtga

DBGET integrated database retrieval system