KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_4182Help
Entry
MSMEI_4182        CDS       T02191                                 

Gene name
sucB
Definition
(GenBank) DlaT, dihydrolipoamide acyltransferase, E2 component of pyruvate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00020  Citrate cycle (TCA cycle)
msg00310  Lysine degradation
msg00380  Tryptophan metabolism
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
Module
msg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEI_4182 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    MSMEI_4182 (sucB)
   00380 Tryptophan metabolism
    MSMEI_4182 (sucB)
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MSMEI_4182 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Trypan_PARP GCV_H TonB_N
Motif
Other DBs
NCBI-ProteinID: AFP40639
UniProt: I7GD73
Position
4368823..4370580
Genome map
AA seq 585 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVELDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEIGGELAVIGEAGEASAEAPSEDSAPAPEPEPEPEPEPQQTQPTAAPAESVES
APAESSAPSQGGGSATPILMPELGESVTEGTVTRWLKNVGDKVEVDEPIVEVSTDKVDTE
IPSPVAGTLLSITANEDDVVEVGGELAKIGDAGAAAEPKPEPKPEPKAEPKPEPKPEPKP
EPKAEPKPEPKPEPKPEPKAEPAPAASSDGSPYVTPLVRKLAAENGIDLSTVKGTGVGGR
IRKQDVLAAAEKAKEAKQAPAASPAAAAPAAPAAASATPAPALAHLRGTTQKANRIRQIT
AKKTRESLQATAQLTQTHEVDMTKIVALRARAKAEFAEREGVNLTFLPFIARAVIDALKI
HPNVNASYNEDTKEITYYDAEHLGFAVDTDQGLLSPVIHNAGDLSLGGLARAIADIAARA
RSGNLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDEYGNES
IGVRSVCYLPLTYDHRLIDGADAGRFLTTIKRRLEEGAFEADLGL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgtccagatgcccgcactaggtgagagtgtcacagaggggacggtgacc
cgctggctcaagcaggagggcgacaccgtcgaactcgacgagccactgctcgaggtgtcc
accgacaaggtcgacaccgagatcccctccccggccgccggtgtgttgacgaagatcgtc
gcgcaggaggacgacaccgtggagatcggtggcgaactcgcggtgatcggcgaggccggc
gaggcatccgccgaggcaccctctgaagactccgccccggctcccgaacccgagcctgag
cccgaacccgagccccagcagacccagccgaccgcggccccggcggaatccgtcgagtcc
gcgcctgccgaatcgtcggccccgtcgcagggcggcgggtcggccaccccgatcctgatg
cccgagttgggcgagtcggtcaccgagggcaccgtgacccgctggctgaagaacgtcggc
gacaaggtcgaggtcgacgagccgatcgtcgaggtgtccaccgacaaggtcgacaccgag
atcccgtcaccggtggcgggcacgctgctgtcgatcaccgccaacgaggacgacgtcgtc
gaggtcggcggcgagctggcgaagatcggcgacgccggcgcggcggccgagccgaagccc
gagccgaaacccgagcccaaggccgagccgaagcccgaacccaagccggaacccaagccc
gagcccaaggccgaacccaagccggaaccgaagcccgaacccaagcctgagcccaaggcc
gagcccgcccccgcggcgagctccgacggttccccctatgtcactccgctggtgcggaag
ttggccgcggagaacgggatcgacctctccacggtcaagggcaccggtgtcggtggccgc
atccgcaagcaggacgtgctcgcggccgccgagaaggccaaggaggccaagcaggctccg
gcagcctcccccgccgcggcggcgcccgcggccccggctgccgcatcggccacgcctgcc
ccggcgctcgcacacctgcgcggcaccacgcagaaggcgaaccggatccgtcagatcacc
gcgaagaagacgcgtgagtcgctgcaggccaccgcgcagctgacgcagacccacgaggtc
gacatgaccaagatcgtggcgctgcgggcccgcgccaaggccgagttcgccgagcgcgaa
ggcgtcaacctcacgttcctgccgttcatcgcgcgtgcggtgatcgacgcgttgaagatc
caccccaacgtcaacgccagctacaacgaggacaccaaggagatcacctactacgacgcc
gagcacctcggcttcgcggtggacaccgaccagggtctgctgtcgccggtgatccacaac
gccggtgacctctcgctgggcggcctggcgcgcgcgatcgccgatatcgccgcccgcgcc
cggtcgggcaacctcaagcccgatgagctggccggtggcaccttcacgatcaccaacatc
ggcagccagggcgcgctgttcgacaccccgatcctggttccgccgcaggcggcgatgctg
ggcacgggtgccatcgtcaagcggccgcgcgtgatcgtcgacgagtacggcaacgagtcg
atcggtgtccggtcggtgtgctacctgccgctcacctacgaccaccgcctgatcgacggc
gccgacgccggacggttcctgaccacgatcaagcgcaggctcgaagagggcgcgttcgag
gccgacctgggtttgtga

DBGET integrated database retrieval system