KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_4724
Entry
MSMEI_4724        CDS       T02191                                 

Definition
(GenBank) Short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00903  Limonene and pinene degradation
msg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEI_4724
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MSMEI_4724
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: AFP41173
UniProt: I7FQY0
Position
4944960..4945805
AA seq 281 aa
MSGRVEGKVAFVTGAARGQGRSHALRLAQEGADIIAIDICGPIRPGAETAIPASTSDDLA
ETANLVKGLDRRVVTAEVDVRDAAAIKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDQTS
EEDWDEMIDINLSGVWKSVKAGVPHIVAGGRGGSIVLTSSVGGLKAYPHCGNYVAAKHGV
VGLMRGFAVELGQHNIRVNTVHPTHVATPMLHNEGTFKMFRPDLENPGPDDMAPICQMFH
TLPIPWVEPIDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctggacgggtggaaggcaaggtcgcattcgtcaccggcgcggcccgcggccagggc
cgtagtcacgcactgcggttggcgcaggaaggcgccgacatcatcgccatcgacatctgc
ggccccattcgccccggcgccgaaaccgccatcccggcatcgacatccgatgaccttgcc
gagaccgcgaacctggtgaagggactcgaccgccgcgtcgtcaccgcggaggtggacgtg
cgcgacgccgcggccatcaaggccgctgtcgacagcggtgtcgagcagctcggcaggctc
gacatcatcgtcgccaacgccggcatcggcaacggcggcgacaccctcgaccagacctcc
gaggaggactgggacgagatgatcgacatcaatctgtccggtgtctggaagtctgtgaaa
gccggtgtcccccatatcgtcgcgggcggacgcggcgggtcgatcgtcctgaccagttcg
gtaggcgggctgaaggcctatccgcactgcggcaactacgtggccgccaagcacggcgtg
gtgggcctcatgcggggcttcgcagtggaactcgggcagcacaacatccgcgtcaacacc
gtgcacccgacgcacgtcgccaccccgatgctgcacaacgagggcaccttcaagatgttc
cgtcccgacctggagaacccgggccccgacgacatggcccccatctgccagatgttccac
acgttgcccatcccgtgggtcgagcccatcgacatcagcaacgccgtgctgttcctggcc
tccgacgaggcccgttacatcacgggcgtgacgttgccggtcgacgcgggaagctgcctc
aagtag

DBGET integrated database retrieval system