KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4975Help
Entry
MSMEI_4975        CDS       T02191                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00300  Lysine biosynthesis
msg01100  Metabolic pathways
msg01120  Microbial metabolism in diverse environments
msg01230  Biosynthesis of amino acids
Module
msg_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MSMEI_4975 (dapE)
Enzymes [BR:msg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MSMEI_4975 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DUF3040 Cyclase AlkA_N
Motif
Other DBs
NCBI-ProteinID: AFP41419
UniProt: A0R2G4
Position
complement(5206431..5207498)
Genome map
AA seq 355 aa AA seqDB search
MGLDLSADPIALTAALVDIPSVSRDERRIADEIEAALRAQAPHFEVIRNGDAVLARTNLG
RPSRVMLAGHIDTVPIADNLPSRIVDGEMYGCGTSDMKAGDAVFLHLAATITEPTHDITL
VMYDCEEIESSANGLGRIERELRDWLTADVAILGEPSGGYIEAGCQGTIRVVISAKGTRA
HSARSWLGDNAIHKLAPVLDRLASYQARSVDIDGCVYREGLSAVRIDGGIAGNVIPDAAS
VTVNFRFAPDRDVDQAVAHVHEVFDGLDVTLELTDAAAGALPGLTQPAAAALVAAAGGQV
RAKYGWTDVARFAALGIPAVNYGPGDPNLAHRVDERVQVAAITAAADMLRTYLTT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggggctagacctgagcgctgatccgatcgcactgaccgccgcgctggtggacatcccc
agtgtgtcgcgcgacgaacgccgcatcgccgacgagatcgaggccgcgttgcgcgcccag
gcgccgcacttcgaggtgatccgcaacggcgacgccgtgctggcccgcaccaacctgggc
cggccgtcgcgcgtgatgctcgcgggtcacatcgataccgtgcccatcgccgacaacctg
cccagccggatcgtcgacggcgagatgtacggctgcggcacctccgacatgaaggcgggc
gacgcggtgttcttgcacctggccgccacgatcaccgagcccacgcacgacatcacgctg
gtgatgtacgactgcgaggagatcgaatcgagcgccaacggcctggggcgcatcgaacgg
gagctgcgcgactggctcaccgctgacgtcgcgatcctcggcgaaccgtcgggtggctac
atcgaagcgggctgccagggcaccatccgcgtcgtgatctccgcgaagggcacacgcgcc
cactcggcccgttcgtggttgggggacaacgcgattcacaaactcgcacctgtgctcgac
cggctggcgtcgtatcaggcgcgctcggttgacatcgacggctgtgtctaccgcgagggg
ctgtccgcggtgcgtatcgacggtggcatcgcgggcaacgtgattcccgacgcggcatcg
gtcaccgtcaacttccggttcgcgccggatcgcgacgtcgaccaggccgttgcgcacgtc
cacgaggtgttcgacggactcgacgtcacgctcgagctgaccgacgccgccgccggtgcg
ctgccgggcctcacgcaacccgcggccgcggcgctcgtggccgccgcaggcgggcaggtg
cgcgccaagtacggctggaccgacgtcgcgaggttcgccgcgctcggcatcccggccgtg
aactacgggccgggcgacccgaatctcgcccaccgtgtcgacgaacgcgtccaggtcgcg
gccatcaccgccgcagccgacatgctgcgcacgtatctgacgacctga

DBGET integrated database retrieval system