KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5679Help
Entry
MSMEI_5679        CDS       T02191                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00480  Glutathione metabolism
msg00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MSMEI_5679
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MSMEI_5679
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MSMEI_5679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFP42114
UniProt: I7GFS6
Position
complement(5904929..5905414)
Genome map
AA seq 161 aa AA seqDB search
MSLKNINLTTLDGKQTTLGELAPGAALVVNVASKCGLTPQYSALEKLAQEYGDRGLTVIG
VPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTDVNGAERHPLYAALTETPDAGGEAG
DIQWNFEKFLLAADGTVVNRFRPRTEPDAPEVIEAIEKVVS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcaagaacatcaacttgaccaccctcgacggcaagcagaccacgctcggcgag
ttggcccctggggccgcactcgtcgtcaacgtcgcctcgaaatgcggtctgacaccgcaa
tacagcgcactggagaaactcgcgcaggaatacggtgaccgcggcctcacggtgatcggt
gtgccctgtaaccaattcatgggacaggaaccgggcacggccgaggaaattcagacgttc
tgttcgaccacctacggcgtgacgttcccgttgctggccaagaccgacgtcaacggcgca
gagcgccacccgctgtacgccgcactgaccgagacccccgacgccggtggcgaggcgggc
gacatccagtggaacttcgagaagttcctgctggccgccgatggcaccgtcgtcaaccgg
ttccggccccgcacagaaccggacgcccctgaggtgatcgaggcgatcgagaaggtcgtt
tcgtaa

DBGET integrated database retrieval system