KEGG   Mycobacterium smegmatis MC2 155: MSMEI_5779Help
Entry
MSMEI_5779        CDS       T02191                                 

Gene name
mhpF
Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
msg00360  Phenylalanine metabolism
msg00362  Benzoate degradation
msg00620  Pyruvate metabolism
msg00621  Dioxin degradation
msg00622  Xylene degradation
msg00650  Butanoate metabolism
msg01100  Metabolic pathways
msg01120  Microbial metabolism in diverse environments
msg01220  Degradation of aromatic compounds
Module
msg_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_5779 (mhpF)
   00650 Butanoate metabolism
    MSMEI_5779 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEI_5779 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5779 (mhpF)
   00622 Xylene degradation
    MSMEI_5779 (mhpF)
   00621 Dioxin degradation
    MSMEI_5779 (mhpF)
Enzymes [BR:msg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEI_5779 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFP42212
UniProt: A0R4S7
Position
complement(5999810..6000733)
Genome map
AA seq 307 aa AA seqDB search
MPKKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSAEGVD
WLLAQSEKPDLVFEATSAYVHRDAAPRYEEAGIRAIDLTPAAVGPGVVPPANLRDHLDAP
NVNMVTCGGQATIPIVHAVSRVVDVPYAEIVASVSSASAGPGTRANIDEFTKTTSAGVQN
IGGAQRGKAIIVLNPAEPPMIMRDTIFCAIPEGADHDAITQSIKDVVAEVQTYVPGYRLL
NEPQFDEPSVVNGGNHLVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKKSAEAS
LASGAQA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaaagtcctccgtcgcgatcgtcggatccggcaacatcagcaccgatctgctc
tacaagctgctccgctcggaatggcttgagccacgctggatgatcggcatcgatccggaa
tccgaaggtttggcgcgggcacgcaaactcggcctggagacatccgccgagggagtggac
tggctgctggcacagagcgaaaagcctgatctggtcttcgaggccaccagtgcctacgtg
caccgtgacgccgcaccgcgctacgaggaagcgggcattcgtgccatcgacctcacgcct
gccgcggtgggtcctggtgtcgtcccgccggccaacctgcgcgaccacctcgacgccccg
aacgtcaacatggtcacgtgcggcggtcaggcgaccatcccgatcgtgcatgccgtaagc
cgcgtggtcgacgtgccctacgccgagatcgtcgcgtcggtgtcgtcggcgtcggcaggc
ccgggcacgcgcgccaacatcgacgagttcaccaagaccacgagcgccggcgtgcagaac
atcggcggtgcgcagcggggcaaggcgatcatcgtcctcaacccggccgaaccgccgatg
atcatgcgcgacaccatcttctgcgccatccccgaaggcgccgaccacgacgccatcacg
cagtccatcaaggacgtcgtcgccgaggtgcagacgtacgtcccgggctaccgcctgctc
aacgaaccgcagttcgacgagccttcggtggtcaacggcggcaaccatctggtcaccacg
ttcgtggaagtggagggtgcgggtgactacctgccgccctacgctggaaatctggacatc
atgaccgccgcggcgacgaaagtcggcgaggaaatcgccaagaaatcggccgaagcaagc
ctcgcgtcaggagcacaggcatga

DBGET integrated database retrieval system