KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_5835Help
Entry
MSMEI_5835        CDS       T02191                                 

Gene name
fadA5
Definition
(GenBank) Acetyl-CoA acetyltransferase FadA5
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00071  Fatty acid degradation
msg00072  Synthesis and degradation of ketone bodies
msg00280  Valine, leucine and isoleucine degradation
msg00310  Lysine degradation
msg00362  Benzoate degradation
msg00380  Tryptophan metabolism
msg00620  Pyruvate metabolism
msg00630  Glyoxylate and dicarboxylate metabolism
msg00640  Propanoate metabolism
msg00650  Butanoate metabolism
msg00900  Terpenoid backbone biosynthesis
msg01100  Metabolic pathways
msg01110  Biosynthesis of secondary metabolites
msg01120  Microbial metabolism in diverse environments
msg01130  Biosynthesis of antibiotics
msg01200  Carbon metabolism
msg01212  Fatty acid metabolism
msg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEI_5835 (fadA5)
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEI_5835 (fadA5)
   00640 Propanoate metabolism
    MSMEI_5835 (fadA5)
   00650 Butanoate metabolism
    MSMEI_5835 (fadA5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSMEI_5835 (fadA5)
   00072 Synthesis and degradation of ketone bodies
    MSMEI_5835 (fadA5)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEI_5835 (fadA5)
   00310 Lysine degradation
    MSMEI_5835 (fadA5)
   00380 Tryptophan metabolism
    MSMEI_5835 (fadA5)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSMEI_5835 (fadA5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEI_5835 (fadA5)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSMEI_5835 (fadA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msg04147]
    MSMEI_5835 (fadA5)
Enzymes [BR:msg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MSMEI_5835 (fadA5)
Exosome [BR:msg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEI_5835 (fadA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFP42268
UniProt: I7FTS0
Position
6064121..6065284
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGSVEQIIGGCVTQYG
EQSNNITRVGWLTAGLPEHVGATTIDCQCGSAQQANHLVAGLIATGAIDIGIACGIEAMS
RVGLGANAGPDRSLIRASSWDIDMPNQFEAAERIAQRRGITRADVDALGLASQRKAKQAW
DEGRFDREISPISAPVLDENKQPTSEWAPVTRDQGLRDTTPEALASLKPVLDGGIHTAGT
SSQISDGAAAVLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTARVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHNADMDKVNVNGGAIALGHPVGSTGARLITTALHEL
ERTGKGTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatcctgtcatcgtcgaagccacccgtagcccgatcggaaaacgcaacgggtgg
ttgtccggtctgcacgccacggaactgctgggtgcggtgcagaaggcgctggtggagaag
gctggcatcgaccccggatccgtcgagcagatcatcggtggctgcgtcacccagtacggc
gagcagtccaacaacatcacccgcgtggggtggctgaccgcgggattgcccgagcacgtc
ggcgccaccaccatcgactgccagtgcggcagcgcgcagcaggccaaccatctggtggcc
ggcctgatcgcgacgggtgcgatcgacatcggcatcgcgtgcggtatcgaggccatgagc
cgcgtgggcctgggcgccaacgcgggcccggaccgttcgctgatccgcgcgtcgtcgtgg
gacatcgacatgcccaaccagttcgaggcggccgaacggatcgcccagcgccgcggcatc
acgcgtgccgacgtcgacgccctcggcctggcgtcgcagcgcaaggccaagcaggcctgg
gacgaaggccggttcgaccgcgagatctcccccatctcggccccggtgctcgacgagaac
aagcagcccacgtcggaatgggctcccgtcacgcgcgaccagggtctgcgtgacaccaca
cccgaagcgctggcgtcgctcaagcccgtgctggacggcggcatccacaccgcgggaacg
tcgtcgcagatctccgacggcgcggccgcggtgctgtggatggacgaggacaaggccaag
gcgctcggcctcaagccgcgggcgcgcatcgtcgcgcaggccaacgtcggcgccgagacc
tactaccacctcgacggcccggtgcagtccaccgcgcgggtgctggagaaggcgggcatg
aagctcggcgacatcgacctcgtcgagatcaacgaggccttcgcgtcggtcgtgctgtcg
tgggcacaggtgcacaatgccgacatggacaaggtgaacgtcaacggcggcgcgatcgcg
ctgggccacccggtcggatcgaccggcgcccgcctgatcaccacggcactgcacgaactg
gagcgcaccggcaagggcaccgcgctcatcacgatgtgcgccggcggggcgctgtccacg
ggcaccatcatcgagcgcatctga

DBGET integrated database retrieval system