KEGG   Mycolicibacterium smegmatis MC2 155: MSMEI_6087Help
Entry
MSMEI_6087        CDS       T02191                                 

Definition
(GenBank) Glutamine amidotransferase class-II
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
msg  Mycolicibacterium smegmatis MC2 155
Pathway
msg00340  Histidine metabolism
msg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MSMEI_6087
Enzymes [BR:msg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     MSMEI_6087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AFP42518
UniProt: A0R5M9
Structure
PDB: 

Position
complement(6315185..6315868)
Genome map
AA seq 227 aa AA seqDB search
MCRHVAWLGAPRSLADLVLDPPQGLLVQSYAPRRQKHGLMNADGWGAGFFDDEGVARRWR
SDKPLWGDASFASVAPALRSRCVLAAVRSATIGMPIEPSASAPFSDGQWLLSHNGLVDRG
VLPLTGAAESTVDSAIVAALIFSRGLDALGATIAEVGELDPNARLNILAANGSRLLATTW
GDTLSVLHRPDGVVLASEPYDDDPGWSDIPDRHLVDVRDAHVVVTPL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggcatgtggcgtggctgggcgcgccgcggtcgttggccgacctggtgctcgac
ccgccgcagggactgctggtgcagtcctacgcaccgcgacgacagaagcacggtctgatg
aacgccgacggttggggcgcagggtttttcgacgacgagggagtggcccgccgctggcgc
agcgacaaaccgctgtggggtgatgcgtcgttcgcgtcggtggcacccgcactacgcagt
cgttgcgtgctggccgcggtgcgctcggccaccatcggcatgcccatcgaaccgtcggcg
tcggcgccgttcagcgacgggcagtggctgctgtcgcacaacggcctggtcgaccgcggg
gtgctcccgttgaccggtgccgccgagtccacggtggacagcgcgatcgtcgcggcgctc
atcttctcccgtggcctcgacgcgctcggcgccaccatcgccgaggtcggcgaactcgac
ccgaacgcgcggttgaacatcctggccgccaacggttcccggctgctcgccaccacctgg
ggggacacgctgtcggtcctgcaccgccccgacggcgtcgtcctcgcgagcgaaccctac
gacgacgatcccggctggtcggacatcccggaccggcacctcgtcgacgtccgcgacgcc
cacgtcgtcgtgacacccctgtga

DBGET integrated database retrieval system