KEGG   Mycolicibacterium smegmatis INHR2: LI98_00925Help
Entry
LI98_00925        CDS       T03432                                 

Definition
(GenBank) transferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00430  Taurine and hypotaurine metabolism
msh00460  Cyanoamino acid metabolism
msh00480  Glutathione metabolism
msh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LI98_00925
   00460 Cyanoamino acid metabolism
    LI98_00925
   00480 Glutathione metabolism
    LI98_00925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:msh01002]
    LI98_00925
Enzymes [BR:msh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     LI98_00925
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     LI98_00925
Peptidases and inhibitors [BR:msh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   LI98_00925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIU18713
Position
206364..208133
Genome map
AA seq 589 aa AA seqDB search
MPFTTRPTLTGWHGMAASTHWLASGTAQAVLERGGNAFDAAAAAGFVLHVAEPHLNGPGG
DMVALVSTATTSEPVVLVGQGPAPEGATIAAFRERGLTHVPGAGALAAAVPAAVETWFHL
LERYGTWRLSDVLGYAAEYAERGIECSEQLSAVLATMARHFTAHWPTSRDVWLPDGTPPA
PGDLVRNPAYAAVLRRLSEAGATGTRVAGIDRARRMWRNEIASAIVEFTSRPHRHSGGGD
HAGVLTTSDFQNLRIGSEASLRLRFRGVDVVKAGFWSSGPVLLQALGILDQAAASRSIDP
DTAAGAHTIVETVKLAMADREAYYGDARPDQGVLGQLLSVEYCAERAGAITDHAATVVDP
GVLPGIRPYRSRTTVTPHDELGTGEPTVSRTGETRGDTCHLDVVDRFGNMISATPSGGWL
QSSPAVPGLGFCLGTRLQMTWLDEDSPSALKPGTRPRTTLSPTMVLEAGVPVTSLGTPGG
DQQDQWQLLYLLRTIVTGMTPQQAIDAPMYHTTAFPGSFVPRTASERGVVVEDRAGTEVI
DGLRGRGHDVTVTDGWSLGRLSMVGRDRVTGRLCAAANPRGGTGYAVGR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcaccacccgcccgaccctgaccggatggcacggcatggccgcgtccacccac
tggctggcgtccggaaccgcgcaagccgtgctggagcgtggcggcaacgcattcgatgcc
gcggccgccgcgggattcgtcctgcacgtcgccgaaccgcatctcaacggtccaggcggg
gacatggtcgcactggtgtccaccgccaccacctcggaacccgtggtcctggtcggacag
ggtcctgcgcccgagggggcgacgatcgcggccttccgggaacgcgggctgacgcacgtg
ccgggagccggtgcgctcgcggcggcggtgcccgccgctgtggagacgtggtttcacctg
ctggagcgttacggcacatggcggctgtccgacgtcctcggctacgccgccgagtacgcc
gagcgcggcatcgagtgcagcgagcagctctcggctgtgctcgccaccatggcccgtcat
ttcaccgcgcactggccgacttcgcgcgacgtgtggctgcccgacggcaccccacccgca
cctggtgacctggtccgcaatccggcgtatgcggccgtgctgcgccggttgtccgaggcc
ggcgcgaccggtacccgcgtggcgggcatcgaccgggcccgccggatgtggcgcaatgag
attgcctcggccatcgtcgaattcacgtcacggccacaccgccactcgggtggcggtgac
catgccggggtgctcaccacatcggacttccagaatctgcggatcggttcggaagcgtcg
ctgcggctgcggttccgcggtgtcgacgtggtcaaggccgggttctggtcatcggggccg
gtgttgttgcaggcgttgggaattctcgaccaggcagcggcatcgcgcagcatcgacccc
gacaccgccgccggggcacacacgatcgtcgagaccgtcaagctggcgatggccgaccgc
gaggcgtactacggcgacgcccgccccgaccagggggtccttgggcaacttctctccgtc
gagtactgcgcggagcgtgctggtgccatcaccgatcacgcagcgaccgtcgtcgatccc
ggtgtgttgccgggcatccggccctaccggtcacggaccaccgtcacgccccacgacgaa
ctcggcacgggtgagccgacggtgtcgcgtaccggcgaaacccgcggtgacacctgtcat
ctggacgtggtggaccgtttcggcaacatgatctcggcaaccccgtccggcgggtggctg
cagtcgtcaccggctgtccctggcctgggcttctgtctgggtacacggctgcagatgacc
tggctcgacgaggacagcccctcggcgttgaagccggggacccgcccgcggacgacgctg
agcccgaccatggtgctcgaggcgggcgtacccgtgacgtcactgggcacgcccggcggt
gaccagcaggaccagtggcaactgctctatctgttgcgcaccatcgtcacaggcatgaca
ccacaacaggcgatcgacgctccgatgtaccacaccaccgcttttcccgggtcgttcgtg
ccgcgtaccgcatcggaacgcggtgtggtggtggaggatcgggccggaaccgaggtgatc
gacggattgcgcggccgcgggcacgacgtgaccgtcacagacggttggtcactcggaagg
ctgtccatggtgggccgagaccgtgtgaccggccggttgtgcgcggccgccaacccccgt
ggcggcaccggttatgccgtcgggcggtga

DBGET integrated database retrieval system