KEGG   Mycolicibacterium smegmatis INHR2: LI98_01535Help
Entry
LI98_01535        CDS       T03432                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00232  Caffeine metabolism
msh00633  Nitrotoluene degradation
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    LI98_01535
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    LI98_01535
Enzymes [BR:msh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     LI98_01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AIU18834
Structure
PDB: 

Position
337999..338826
Genome map
AA seq 275 aa AA seqDB search
MAMDLSGYLARIGLDGRPRPDLGTLHAIVAAHNRSIPFENLDPLLGIPVADLSAEALSAK
LVDRRRGGYCYEHNGLLGYVLEELGFDVERLSGRVVWMRADDAPLPAQTHNVLSVAVPGA
DGRYLVDVGFGGQTLTSPIRLEAGPVQQTRHEPYRLTRRGDHHTLAAQIRGEWQPLYTFT
TEPRPRIDLEVGSWYVSTHPGSHFVTGLTVAVVTDDARYNLRGRNLAVHRSGATERIRFD
SAAQVLDAIVNRFGIDLGDLAGRDVQARVAEVLDT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggacctcagcgggtatctcgcgcggatcggcctcgacgggcggccgcgtccc
gatctcggcacattgcacgcgatcgtcgcggcccacaaccgctcgatcccgttcgagaac
ctcgatccgctgctcggcatcccggtggccgacctgagtgccgaggccctgtccgccaag
ctcgtggaccgccgccgcggcgggtactgctacgaacacaacggtctgctcggctacgtg
ctggaggaactgggcttcgacgtcgagcgcctgtccgggcgggtggtgtggatgcgggcc
gacgacgcaccactgcccgcccagacccacaacgtgctgtcggtcgcggtgccgggcgcc
gatggccggtacctggtcgacgtgggcttcggcggacagacgctgacctcgccgatccgg
cttgaggccggcccggtgcagcagacccgccacgagccctaccggctcacccggcgtggt
gaccaccacacgctggcggcccagatccgcggtgagtggcaaccgctgtacacgttcacc
accgagccgcggccgcgcatcgacctcgaggtcggaagctggtacgtctcaacacatccg
gggtcacacttcgtcaccgggctcacggtcgcggtggtcaccgacgacgcgcggtacaac
ctgcgggggcgcaacctggcggtccaccggtccggtgcgaccgagcgcatccggttcgac
agcgcggcacaggtgctcgacgccatcgtcaaccggttcggcatcgacctcggcgatctg
gccggccgtgacgtccaggcacgtgtcgccgaggtgctcgacacctga

DBGET integrated database retrieval system