KEGG   Mycolicibacterium smegmatis INHR2: LI98_07190Help
Entry
LI98_07190        CDS       T03432                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:msh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LI98_07190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:msh03011]
    LI98_07190
Ribosome [BR:msh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LI98_07190
  Bacteria
    LI98_07190
  Archaea
    LI98_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AIU19926
UniProt: A0A0D6H7V2
Structure
PDB: 

Position
1540398..1540859
Genome map
AA seq 153 aa AA seqDB search
MSTVTEFPSATAKARYVRVSATKARRVIDLVRGKSVEEALDILRWAPQAASEPVAKVIAS
AAANAQNNEGLDPSTLVVATVYADEGPTAKRIRPRAQGRAFRIRKRTSHITVIVESRPPK
QKGASAASARSRRAQGSKAAATKKSAETKEGSE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgtcactgaatttccatccgcgacggcgaaggcacgctacgtgcgtgtctcg
gccaccaaggcccgccgcgtcatcgacctggtccgcggcaagagcgtcgaggaagccctc
gacatcctgcggtgggcgccgcaggccgccagcgaaccggtcgccaaggtgatcgcgagc
gctgccgccaacgcgcagaacaacgaggggctggacccgtccaccctggtggtcgccacc
gtctacgccgacgagggcccgaccgccaagcgcatccgtccgcgtgcccagggccgtgcc
ttccggatccgcaagcgcaccagccacatcaccgtgatcgtggagagccgtccgcccaag
cagaagggcgcctccgccgcctcggcgcgtagccgtcgtgcgcagggcagcaaggctgct
gcgacgaagaagtctgccgagacgaaggagggctcggagtag

DBGET integrated database retrieval system