KEGG   Mycobacterium smegmatis INHR2: LI98_11075Help
Entry
LI98_11075        CDS       T03432                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh00071  Fatty acid degradation
msh00072  Synthesis and degradation of ketone bodies
msh00280  Valine, leucine and isoleucine degradation
msh00310  Lysine degradation
msh00362  Benzoate degradation
msh00380  Tryptophan metabolism
msh00620  Pyruvate metabolism
msh00630  Glyoxylate and dicarboxylate metabolism
msh00640  Propanoate metabolism
msh00650  Butanoate metabolism
msh00900  Terpenoid backbone biosynthesis
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01120  Microbial metabolism in diverse environments
msh01130  Biosynthesis of antibiotics
msh01200  Carbon metabolism
msh01212  Fatty acid metabolism
msh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI98_11075
   00630 Glyoxylate and dicarboxylate metabolism
    LI98_11075
   00640 Propanoate metabolism
    LI98_11075
   00650 Butanoate metabolism
    LI98_11075
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI98_11075
   00072 Synthesis and degradation of ketone bodies
    LI98_11075
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI98_11075
   00310 Lysine degradation
    LI98_11075
   00380 Tryptophan metabolism
    LI98_11075
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI98_11075
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI98_11075
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI98_11075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msh04147]
    LI98_11075
Enzymes [BR:msh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI98_11075
Exosome [BR:msh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI98_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIU20667
UniProt: A0A0D6HPE1
Position
2303115..2304290
Genome map
AA seq 391 aa AA seqDB search
MPKPVIVGAARTAIGRSFKGTLVNTPPETLITTVLPEIVRRSGVDPADIDDIIFAESHYG
GGDLARYAADATGLQHVPGQSVNRHCAGSLTAIGNAAAQIGSGMERVLIAGGVQSLSMTP
LVNWRIPGPELKFEERWMPPTHVETPDAPTKDMSITVGWNTAQAAGISREEMDAWAARSH
QRAIAAIDAGKFLDEIVPLKVTQFDGSVIDFSVDEHPRRDTTVEKLAGLKVLHPEIEGFS
ITAGNSSGTNDAAAGVAVVDSEYAAANGLNVMATVRAWGAVGVPPRDTGLGGVRVIGKVL
DRAGLKPSDVALWEINEAFASVPIAACKEYGLDEELVNFNGSGCSLGHPIAASGARMVTT
LVYELQRRGGGIGVAAMCAGGGQGGAVVIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacccgtcatcgtcggtgccgcccgcacggccatcgggcggtccttcaaagga
actctggtcaacaccccgccggagacgctgatcaccacggtgctgccggagatcgtgcgg
cgctcaggcgtcgacccggccgacatcgatgacatcatcttcgccgagtcccattacggc
ggaggcgatctcgcccgctatgcggccgatgcgacgggtctgcagcacgtgccgggacag
tcggtcaaccggcactgcgcgggcagcctcaccgcgatcggcaacgccgccgcgcagatc
gggtcgggtatggaacgtgtgctcatcgccggcggcgtgcagtcgttgtcgatgaccccg
ctggtgaactggcgcattcccgggccagagctgaagttcgaagagcgctggatgccgccg
acgcacgtcgagacaccggacgcgccgaccaaggacatgtcgatcacggtcggctggaac
accgcgcaggccgcaggcatcagccgtgaggagatggacgcgtgggcggcccggtcgcat
cagcgcgcgatcgcggcgatcgacgcgggcaagttcctcgacgaaatcgtgccgctcaag
gtcacccagttcgacggttcggtgatcgacttcagcgtcgacgagcacccccgccgcgac
acgaccgtcgagaagctcgcgggcctgaaggttctgcatcccgaaatcgagggcttctcg
atcacggcgggcaacagcagcggtaccaacgacgccgcggcgggcgtcgcggtggtcgac
agcgagtatgccgccgccaacggcctgaacgtcatggccaccgtgagggcatggggcgcc
gtcggtgtcccgccgcgcgacaccggcctgggcggcgtcagggtgatcggcaaggtgctg
gaccgcgcggggctcaagccgtcggacgtcgcgctgtgggagatcaacgaggcgttcgca
tccgtgccgatcgcggcgtgcaaggagtacggcctcgacgaggaactggtgaacttcaac
ggcagcggctgcagcctggggcatccgatcgcggcgtcgggcgcgcgcatggtcacgacc
ctggtctacgaactgcagcgccgcggcggcggcatcggcgtcgccgcgatgtgtgccggc
ggcgggcagggcggcgcggtcgtcatcgaggtctaa

DBGET integrated database retrieval system