KEGG   Mycobacterium smegmatis INHR2: LI98_17955Help
Entry
LI98_17955        CDS       T03432                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh00071  Fatty acid degradation
msh00072  Synthesis and degradation of ketone bodies
msh00280  Valine, leucine and isoleucine degradation
msh00310  Lysine degradation
msh00362  Benzoate degradation
msh00380  Tryptophan metabolism
msh00620  Pyruvate metabolism
msh00630  Glyoxylate and dicarboxylate metabolism
msh00640  Propanoate metabolism
msh00650  Butanoate metabolism
msh00900  Terpenoid backbone biosynthesis
msh01100  Metabolic pathways
msh01110  Biosynthesis of secondary metabolites
msh01120  Microbial metabolism in diverse environments
msh01130  Biosynthesis of antibiotics
msh01200  Carbon metabolism
msh01212  Fatty acid metabolism
msh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI98_17955
   00630 Glyoxylate and dicarboxylate metabolism
    LI98_17955
   00640 Propanoate metabolism
    LI98_17955
   00650 Butanoate metabolism
    LI98_17955
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI98_17955
   00072 Synthesis and degradation of ketone bodies
    LI98_17955
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI98_17955
   00310 Lysine degradation
    LI98_17955
   00380 Tryptophan metabolism
    LI98_17955
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI98_17955
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI98_17955
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI98_17955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msh04147]
    LI98_17955
Enzymes [BR:msh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI98_17955
Exosome [BR:msh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI98_17955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C OB_aCoA_assoc Holin_2-3
Motif
Other DBs
NCBI-ProteinID: AIU21991
Position
complement(3671796..3673268)
Genome map
AA seq 490 aa AA seqDB search
MSVNRTPVLVGYGQVSQYDENPATEPVDLMAEAARNAADPRVLQAVDSVRVVNLLSWRYR
DPGLLLAGRIGAAGARTRYTGIGGNVPQTLVNHACLDLQAGRAEVVLIAGAETWRTRSRL
RARGVRPDWTRQDDTVPVAPGGDDNVPMAGDAENRIKLDRPAFVYPMFEQALRIAAGETP
DEHRDRIGALWSRFSAVAARNPHAWNRDAVTAQQITQVGPDNRMISWPYPKLMNSNNMVD
QGAVLILTTVQMATYLQIPMDRWVFPYAGTDSHDTYAIGERDELHRSPAIRIAGRRVLEL
AGADIDAIDFVDVYSCFPSAVQVAAAELGLPTDDPARPLTVTGGLTFAGGPWNNYVTHSI
ATMAEKLVAEPGTRGLITANGGYLTKHSFGVYGTEPPEQEFRWEDVQSVVDAEPTRKLAV
EWVGTGTVESWTTPFNRDGAPEKAFLAVRTPDGARTLAVITDESQAAATVREDIAGARVE
VHADGTATLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtgaatcgaacgcccgtgttggtcgggtacggccaggtcagtcaatacgacgag
aaccctgccaccgaaccggtggacctgatggccgaggccgccaggaacgccgcggatcca
cgtgtgctgcaggccgtggactcggtgcgcgtggtcaacctgttgtcgtggcggtaccgg
gacccgggcctgctgctcgcaggtcgcatcggcgccgccggggcgcggacgcggtacacg
ggtatcggtggcaacgtgccgcagaccctggtcaatcacgcgtgcctggatctgcaggcc
ggacgtgccgaggtggtgctgatcgcgggtgcagagacgtggcggacccgcagtcgtctg
cgggcgcgcggggtgcgcccggactggacacgtcaggacgacaccgtgcccgtggccccg
ggtggcgacgacaacgtccccatggccggtgacgccgagaaccggatcaagctggaccgc
ccggcgttcgtgtatccgatgttcgagcaggcgctgcggatcgcggcgggggagacaccc
gatgagcaccgcgaccggatcggtgcgctgtggtcgcggttcagcgccgtggccgccagg
aacccgcacgcctggaatcgtgacgcagtgaccgcgcagcagatcacgcaggtggggccg
gacaaccggatgatcagctggccgtacccgaagctcatgaactccaacaacatggtcgac
cagggtgcggtgctgatcctcaccacggtccagatggcgacctaccttcagatccccatg
gaccgctgggttttcccgtacgcgggaaccgattcacacgacacctacgcgatcggggaa
cgcgacgagttgcaccggtccccggcgatccgcatcgccggacgccgggtgctcgaactg
gcgggcgccgatatcgacgcgatcgacttcgtcgacgtgtactcgtgctttccctcggcg
gtccaggtcgcggccgccgaactcgggttgccgaccgacgatcccgcacggccgctcacg
gtgaccggaggcctgaccttcgcgggcggaccatggaacaactacgtcacgcactcgatc
gcgaccatggccgagaagctcgtcgccgagcccggcacgcgcggattgatcaccgccaac
ggcggatacctcaccaagcacagcttcggggtgtacggcaccgaaccgcctgaacaggaa
ttccgttgggaggacgtgcaatccgtggtggatgccgagcccacccgcaagctggccgtg
gaatgggtgggcaccgggacggtcgaatcctggaccacgccgttcaaccgggacggtgcg
ccggagaaggcgttcctggcggtgcgcacgcccgatggcgcgcgcacgctcgcggtgatc
accgacgagtcgcaggccgcggccaccgtgcgtgaggacatcgccggggcacgcgtcgag
gtgcacgccgacggcaccgcgaccctgttgtga

DBGET integrated database retrieval system