KEGG   Mycolicibacterium smegmatis INHR2: LI98_31665Help
Entry
LI98_31665        CDS       T03432                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
msh  Mycolicibacterium smegmatis INHR2
Pathway
msh00052  Galactose metabolism
msh00520  Amino sugar and nucleotide sugar metabolism
msh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI98_31665
   00520 Amino sugar and nucleotide sugar metabolism
    LI98_31665
Enzymes [BR:msh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     LI98_31665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase FAD_oxidored Pyr_redox DAO Pyr_redox_2 NAD_binding_9 Thi4 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AIU24632
UniProt: A0A0D6J1Y0
Structure
PDB: 

Position
complement(6474960..6476198)
Genome map
AA seq 412 aa AA seqDB search
MTSISHPVAPSQSTGNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEP
EPETGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMGLGLVSQ
FFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPLYEAFIKHYTAKQWQTDPK
DLPASNITRLPVRYTFDNRYFNDTYEGLPVEGYTKWLENMAADERIEVRLDTDWFDVRDD
LRAANPDAPVVYTGPLDRYFDYAEGRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYT
RIHEFRHFHPERTYPTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETA
SAKVLFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVTEDESSKA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccatatcgcacccggtcgctccgtcccagtccaccggtaatttcgacctattc
gtcgtcggatccggcttcttcggtctgacgatcgccgagcgtgcggcgacgcagttgggt
aaacgggtccttgtcatagagcgccgcccgcacatcggcggcaacgcctactcggagccc
gaaccggagaccggcatcgaggtccacaagtacggcgcgcacctgttccacacgtccaac
aagcgcgtgtgggactacgtgcgccagttcaccgacttcaccggttaccagcaccgcgtc
ttcgccatgcacaacgggcaggcctaccagttccccatgggtctcggcctggtgagccag
ttcttcgggcgctacttctccccggacgaggccagggcgctgatcgccgagcaggccagc
gagatcgacaccaaggacgccaagaacttcgaggagaaggccatcagcctggtcggcaga
cccctctacgaggcgttcatcaagcactacacggccaagcagtggcagaccgaccccaag
gacctgcccgcgtccaacatcacccggctgccggtgcgctacacgttcgacaaccgctac
ttcaacgacacctacgaggggctgcccgtcgagggctacaccaagtggctcgagaacatg
gccgccgacgagcgcatcgaggtgcgcctggacaccgactggttcgacgtgcgtgacgac
ctgcgcgcggccaacccggacgcgcccgtggtctacacgggtccgctggaccgctacttc
gactacgccgagggccgccttggttggcgcacactcgatttcgagctcgaggtgctcgag
acgggcgacttccagggcacgccggtgatgaactacaacgacctcgacgtgccgtacacg
cgcatccacgagttccggcacttccaccccgagcgcacatatcccaccgacaagaccgtg
atcatgcgcgagtactcgcggttcgccgacaacgacgacgagccgtactacccgatcaac
accgaggccgaccgtgccgtgctggcggcctaccgcgcccgggccaaagccgaaactgcc
tcggcgaaggtgcttttcggcggccggctgggcacctaccaatacctcgacatgcacatg
gcgatcgccagcgcgctcagcatgttcgacaacgtactggcgccgcacctgtccgagggc
gcgtcgctggtcaccgaagacgaaagcagcaaagcatga

DBGET integrated database retrieval system