KEGG   Mycolicibacterium smegmatis INHR2: LI98_32475Help
Entry
LI98_32475        CDS       T03432                                 

Definition
(GenBank) peroxidase
  KO
K15733  dye decolorizing peroxidase [EC:1.11.1.19]
Organism
msh  Mycolicibacterium smegmatis INHR2
Brite
KEGG Orthology (KO) [BR:msh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI98_32475
Enzymes [BR:msh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.19  dye decolorizing peroxidase
     LI98_32475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dyp_perox TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIU24789
Position
complement(6622611..6623816)
Genome map
AA seq 401 aa AA seqDB search
MADGSSMRVNRRRLLTGGAAALAAGAVVTASGVANSAVVDHGFGTDAEPFYGPHQAGIAT
APQAHGVFLAFDVKPTDTRSERDTVAAILRLWTVDAARLTAGRPAVADTEPELATRPARL
TVTVGLGPGLLGRLGATVPRSARDLPEFGPDRLQERWSGGDLLLQICGDDPVSIAHATRV
LTKNVRAMAVQRWRQAGFRNARGADRQGTSMRNLMGQVDGTVNLAPVEFDELVWLGDEVY
PGLAGGTLMVLRRIEMQLDTWDELDRESKELTVGRTLDSGAPLTGHRETDEPDFTLARNG
IPVIPPNSHIALARHRHDGERFLRRPYNYDDPPEPGQTSNTGLIFATYQRDIDTQFLPVQ
QRLAQFDALNQWTTAIGSSVFVILPGVRSPEGYLGQELLAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggatcctcgatgagggtcaaccggcggcgcctcctcaccgggggcgccgcc
gcgttggccgcgggcgcggtggtcacggcgtccggcgtcgcgaactccgctgtcgtcgac
cacgggttcggcaccgatgccgaaccgttctacggaccgcaccaggccgggatcgccacc
gccccacaggcacacggcgttttcctcgccttcgacgtgaaacccacggacacccgcagc
gagcgggacaccgtggccgcgatcctgcggttgtggaccgtcgacgccgcacgtctgacc
gcgggccggcccgcggtggccgacaccgaacccgaactggcgacccgcccggcccggctc
acggtcaccgtggggttgggccccggtctgctggggaggttgggggccaccgtgccgcgc
tcggccagggacctgccggaattcggcccggaccgcctccaggagcggtggtccggtggc
gatctgctgctgcagatctgcggtgacgacccggtgtcgatcgcgcatgccacccgggtg
ctcaccaagaatgtccgcgcgatggccgtgcagcggtggcgccaggccggattccgcaac
gcacgcggggccgaccggcaaggcacgtcgatgcgcaacctgatgggacaggtggacggg
acggtcaacctggcgcccgtcgagttcgatgaactggtgtggctgggcgacgaggtgtat
ccgggattggccggcggcacactgatggtgttgcggcgcatcgagatgcaactcgacacg
tgggatgagctggaccgggagagcaaggagctcacggtcgggcggacactcgacagcggt
gccccgctgacggggcatcgggaaaccgacgagccggatttcacattggcacgcaacggt
attccggtgattccaccgaactcgcacatcgcactggcgcgtcaccgccacgacggtgaa
cggttcctgcgcaggccgtacaactacgacgacccgcccgaaccgggtcagacgtcgaac
acggggttgatcttcgcgacgtatcagcgtgacatcgacacgcagttcctgccggtgcag
cagcgactcgcgcagttcgacgcactcaaccagtggacgacggcgatcgggtcgtcggtg
ttcgtcatcctgccgggggtgcgttccccggaggggtatctgggtcaggaattgcttgca
ggctga

DBGET integrated database retrieval system