KEGG   Mycobacterium shigaense: MSG_00237Help
Entry
MSG_00237         CDS       T05717                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mshg  Mycobacterium shigaense
Pathway
mshg00010  Glycolysis / Gluconeogenesis
mshg00053  Ascorbate and aldarate metabolism
mshg00071  Fatty acid degradation
mshg00280  Valine, leucine and isoleucine degradation
mshg00310  Lysine degradation
mshg00330  Arginine and proline metabolism
mshg00340  Histidine metabolism
mshg00380  Tryptophan metabolism
mshg00410  beta-Alanine metabolism
mshg00561  Glycerolipid metabolism
mshg00620  Pyruvate metabolism
mshg00625  Chloroalkane and chloroalkene degradation
mshg00903  Limonene and pinene degradation
mshg01100  Metabolic pathways
mshg01110  Biosynthesis of secondary metabolites
mshg01120  Microbial metabolism in diverse environments
mshg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSG_00237
   00053 Ascorbate and aldarate metabolism
    MSG_00237
   00620 Pyruvate metabolism
    MSG_00237
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSG_00237
   00561 Glycerolipid metabolism
    MSG_00237
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSG_00237
   00310 Lysine degradation
    MSG_00237
   00330 Arginine and proline metabolism
    MSG_00237
   00340 Histidine metabolism
    MSG_00237
   00380 Tryptophan metabolism
    MSG_00237
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSG_00237
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSG_00237
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSG_00237
Enzymes [BR:mshg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MSG_00237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAX90403
UniProt: A0A1Z4EBS6
Position
241601..243031
Genome map
AA seq 476 aa AA seqDB search
MREYLKFYIDGKWVDPLQPNPFDVDNPATEQVSGKISLGSAADVDVAVKAARRAFAGWSQ
STREERLDLLQAILAEYQKRAGDIAAAITEEMGAPPSLAAGPQVFLGIGHLTTAIDALKN
FPFSEQRGETLIAKEPIGVCGLITPWNWPINQVAVKVYPALATGCTVVLKPSEVAPYSPY
LFAEVLDAAGVPAGVFNLVNGDGAGVGVALATHPDIDMVSFTGSTRAGIEVAKLAAPTVK
RVTQELGGKSPNIVLDDSGFTESVTAGVANMMPNSGQSCNAPSRMLVPNSRMDEAITIAR
AVAEEVRVGKADDKTAIGPVASKTQFDKVQGLIQKGIDEGATVVVGGPGRPAGLVQGYYV
KPTVFAHVTNDMTIAREEIFGPVLCILGYDDLDQAVEIANDTEYGLAGYVSGADLDKARE
VARKIRAGWVTINHAFDMNAPFGGYKRSGNGREWSAFAFEEYLEVKSTLGYAPSSA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatacctcaagttctacatcgacggaaagtgggttgatccgttgcagcccaat
cccttcgacgtggataaccccgcgaccgagcaggtgtccgggaagatctcgctgggctcg
gcggccgacgtcgacgtggctgtcaaggccgcccggcgcgctttcgccggctggtcgcag
agcacccgcgaagagcgcttggacctgttgcaggccatcctcgccgaataccagaagcgg
gcgggcgatatcgccgccgcgatcaccgaggaaatgggcgcgccgccctcgctggccgcg
gggccgcaggtctttctcgggatcgggcacctgacgacggccatcgacgccctgaagaac
ttcccgttctccgagcagcgcggggagacgctgatcgccaaggagccgatcggtgtctgc
ggtctgatcacgccgtggaactggccgatcaaccaggttgcggtcaaggtctacccggcg
ctggcgaccggctgcaccgtcgtcctgaaaccgtctgaggtggcgccgtattcgccgtat
ctcttcgccgaggtgctcgatgcggcgggcgtgcccgccggggtgttcaacctggtcaac
ggtgacggcgcgggcgtgggcgtggccctggcgacccatcccgacatcgacatggtgtcg
ttcaccggctccacgcgcgccggcatcgaggtggccaagcttgccgccccgacggtcaag
cgggtgacccaggagctcggtggcaagagccccaacatcgtcctggacgacagtggcttc
accgagagcgtgaccgccggcgtggccaacatgatgcccaactcagggcagagctgtaat
gcgccgtcgcggatgctggttccgaattcgcggatggacgaggcgattaccatcgcgcgt
gcggtggcagaggaggtccgggtgggtaaggccgacgacaagacggcgatcggcccggtg
gcgtccaagacgcagttcgacaaggttcagggcctgatccagaagggcatcgacgagggc
gcgaccgtcgtggtggggggcccgggccggccggcggggctggtgcagggttactacgta
aagccgaccgtcttcgcgcatgtcaccaacgacatgacgatcgcgcgcgaggagatcttc
gggccggtgctgtgtatcctcggctacgacgacctggaccaggccgtcgagatcgccaac
gacaccgaatacggcctcgccgggtacgtttcgggagccgacctggacaaggcccgcgag
gtggcccgcaagatccgcgcgggctgggtgacgatcaaccacgccttcgacatgaacgcg
ccgttcggcggctacaagcgcagcggcaacggccgcgaatggagcgcgttcgccttcgag
gagtacctggaagtgaagagcaccctgggctacgcacccagcagcgcctga

DBGET integrated database retrieval system