KEGG   Mycobacterium shigaense: MSG_01700Help
Entry
MSG_01700         CDS       T05717                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mshg  Mycobacterium shigaense
Pathway
mshg00900  Terpenoid backbone biosynthesis
mshg01100  Metabolic pathways
mshg01110  Biosynthesis of secondary metabolites
mshg01130  Biosynthesis of antibiotics
Module
mshg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSG_01700 (dxr)
Enzymes [BR:mshg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MSG_01700 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Epimerase Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAX91854
UniProt: A0A1Z4EFW2
Position
1790188..1791474
Genome map
AA seq 428 aa AA seqDB search
MGSKSVRGARHRKALRADYEHGAPKRHNEGVTRPTTTDPGARLRVLVLGSTGSIGTQALE
VIADNPDRFEVVGLAAGGANPETLRRQRAETGVTNIAVPDERAAQHIGDVPYRGPDAVTR
LVEETEADVVLNALVGALGLRPTLAALQTGARLALANKESLVAGGPLVLQAARPGQIVPV
DSEHSALAQCLRGGAPDEVAKLVLTASGGPFRGWSATDLEAVTPEQAGAHPTWSMGPMNT
LNSASLVNKGLELIETHLLFGIAYDRIDVVVHPQSIVHSMVTFVDGSTIAQASPPDMKLP
ISLALGWPRRVAGAAASCDFSTASSWEFEPLDAEVFPAVELARYAGETGGCLTAVYNAAN
EEAAAAFLQGRITFGAIVRTIADVLHAADKWAPQLGEVPATVDDVLDAQRWARERAQHVV
RAASPAGV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgaaatccgttcgcggtgcgcgccaccggaaagcgctacgggcggactacgaa
cacggggcgccgaaacggcacaatgagggggtgacccgcccgacgaccaccgatcccggc
gcgcgcctgcgcgtcctggtgctgggcagcaccggttccatcggcacccaggcgctggag
gtcatcgccgacaaccccgaccgcttcgaggtggtcgggctggcggccggcggggcaaac
cccgagacgctgcgacgccagcgcgccgagacgggcgtgaccaacatcgccgtgcccgac
gagcgcgccgcgcagcacatcggtgacgtcccctaccgcggtcccgacgccgtcacccgg
ctggtcgaggagaccgaggccgacgtcgtcctcaacgcactggtcggggccctgggcctg
cggccgacgctggccgccctgcagacgggtgcccggctggcgctggccaacaaggaatcg
ttggttgccggcggtccgctggtgctgcaggcggcgcggccaggccagatcgtgcccgtc
gactccgagcactccgcgctggcccagtgcctgcgcggcggggcgcccgacgaggtcgcc
aagctggtgctgaccgcctccggcgggccgttccgcggctggtccgccaccgacctggag
gccgtcacgcccgagcaagccggcgcccacccgacctggtcgatgggaccgatgaacacg
ctgaactcggcgtcgctggtcaacaaggggctcgagctcatcgagacgcatctgctgttc
ggcattgcctacgaccgcatcgacgtcgtggtgcacccgcagtcgattgttcattcgatg
gtcacgttcgtcgacggttcgacgatcgcgcaggccagccccccggacatgaagctgccg
atctcgctggcgctgggctggccccggcgggtggccggcgcggccgcctcctgcgacttc
agcaccgcctctagctgggaattcgaaccgctcgacgccgaggttttccccgcggtggag
ctggcccggtatgccggggagaccggcggctgcctgacggcggtctacaacgccgccaac
gaggaggcggccgccgcgttcctgcaggggcggatcacgttcggcgccattgtcagaaca
atcgccgacgtgctgcacgccgcggacaaatgggcgccgcaattgggggaagtacccgct
accgtggatgacgtactagacgcgcagcgctgggcgcgtgagcgagcacaacacgtcgtg
cgagccgcgagccccgcaggagtctga

DBGET integrated database retrieval system