KEGG   Mycobacterium shigaense: MSG_01772Help
Entry
MSG_01772         CDS       T05717                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mshg  Mycobacterium shigaense
Pathway
mshg00670  One carbon pool by folate
mshg00790  Folate biosynthesis
mshg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MSG_01772 (folA)
   00670 One carbon pool by folate
    MSG_01772 (folA)
Enzymes [BR:mshg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MSG_01772 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAX91925
UniProt: A0A1Z4EG30
Position
1866635..1867132
Genome map
AA seq 165 aa AA seqDB search
MTDIGLVWAQSTSGVIGRGGDIPWRVPEDLAHFKQVTFGHTVVMGRRTWDSLPAAVRPLP
GRRNVVLSRQPDFTADGAQVTASLEAAFSFAGTDPETWVIGGAEIYVLGLPHATRCEVTE
VDIHLPRDDDDALAPVLDETWRGETGDWLVSRAGLRYRFHSYCRA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatcggactggtctgggcgcagtcgacgtccggcgtgatcgggcgtggcggc
gacatcccgtggcgggtgcccgaagacctggcccacttcaagcaggtcaccttcggacac
accgtggtgatgggcaggcgaacctgggactcgctgcccgccgcggtacggccgctgccg
ggccgcagaaacgtcgtactgagccgccagcccgacttcaccgcggacggagcccaagtg
acggcgtcgctcgaggcggctttttccttcgcggggaccgaccccgagacctgggtgatc
ggcggcgcggagatctatgtgctggggctgccgcacgccacccgatgcgaggtcaccgag
gtcgacatccatctgccgcgcgacgacgacgacgcgctggccccggtgctcgacgagacc
tggcggggcgaaacgggggactggctcgtcagccgcgcggggttgcgctaccgctttcac
agctactgtcgggcctga

DBGET integrated database retrieval system