KEGG   Mycobacterium shigaense: MSG_02610Help
Entry
MSG_02610         CDS       T05717                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mshg  Mycobacterium shigaense
Pathway
mshg00620  Pyruvate metabolism
mshg00630  Glyoxylate and dicarboxylate metabolism
mshg01100  Metabolic pathways
mshg01110  Biosynthesis of secondary metabolites
mshg01120  Microbial metabolism in diverse environments
mshg01200  Carbon metabolism
Module
mshg_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSG_02610 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    MSG_02610 (glcB)
Enzymes [BR:mshg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MSG_02610 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DivIC
Motif
Other DBs
NCBI-ProteinID: BAX92754
UniProt: A0A1Z4EIF9
Position
complement(2778484..2780670)
Genome map
AA seq 728 aa AA seqDB search
MTDRVSAGNLRVARVLYDFVNNEALPGTGIDADSFWAGVDKVVTDLTPQNQDLLARRDQL
QAQIDKWHRQRVIEPLDIDAYRQFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVP
VLNARFALNAANARWGSLYDALYGTDVIPETDGAEKGTSYNTVRGDKVIAYARKFLDQAV
PLAAGSWTDATGLSITDGQLQITLGDQTTALASPEKFVGYTGELGSPNWSVLLVNHGLHI
EILIDPQSPVGKTDAAGIKDVVLESAITTIMDFEDSVTAVDADDKVIGYRNWLGLNKGDL
AEDVKKDGKTFTRVLNADRTYTTPDGGELTVPGRSLLFVRNVGHLMTNDAIVDADGIEVF
EGIMDALFTGVTAIHGLKTGDANGPLTNSRTGSVYIVKPKMHGPEEVAFTCELFSRVEDV
LGLPQGTLKVGIMDEERRTTLNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIR
KGAMKNSTWIKAYEDANVDTGLAAGFKGRAQIGKGMWAMTELMADMVEQKIGQPKAGATT
AWVPSPTAATLHAMHYHYVDVGAVQEELAGQKRTNIDELLTIPLAKELAWAPEEVREELD
NNCQSILGYVVRWVEQGVGCSKVPDIHNVALMEDRATLRISSQLLANWLRHGVITEEDVR
ASLERMAPLVDQQNAGDAAYRAMAPNFDDSIAFAAAQELILSGGRQPNGYTEPILHRRRR
EFKARARD
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcgtctccgcgggtaatttacgcgtggcccgagtcctttacgacttcgtc
aataacgaggccctgcccggcaccggcatcgacgcggacagcttctgggcgggggtcgac
aaggtggtcaccgacctcaccccgcagaaccaggatctactggcccggcgcgaccagctg
caggcccagatcgacaagtggcaccggcagcgcgtgatcgaacccctcgacatcgacgcc
taccgtcagttcctcaccgaaatcggctacctgctccccgaacccgcggacttcacgatc
accacctcgggcgtcgacgacgagatcaccacgaccgccggaccgcagctggtggtgccg
gtgctcaatgcccggttcgcgctgaacgccgccaatgcgcggtggggctcgctgtacgac
gccttgtacggcaccgatgtcatcccggagaccgacggcgccgagaagggcaccagctac
aacacggtgcgcggcgacaaggtgatcgcctacgcgcgcaagttcctcgaccaggcggtg
ccgttggcagcgggctcctggaccgacgcgaccgggctgagcatcaccgacggccagctg
cagatcaccctcggcgaccagaccaccgcgttggccagccccgagaagttcgtcgggtac
acgggcgaactcggctcccccaactggtcggtgctgctggtcaatcacggcctgcacatc
gagatcctcatcgacccgcagtcccccgtcggcaagaccgacgccgccggcatcaaggac
gtggtcctggaatcggcgatcaccacgatcatggacttcgaggactcggtgaccgccgtg
gacgccgacgacaaggtcatcggctaccgcaactggctgggactgaacaagggcgacctc
gccgaggacgtcaagaaggacggcaagaccttcacccgcgtgctcaacgccgaccgcacc
tacaccacgccggacggcggcgagctgaccgtgcccggtcgcagcctgctgttcgtccgc
aacgtcggccacctgatgaccaacgacgcgatcgtcgacgccgacggaatcgaggtgttc
gaagggatcatggacgccctgttcaccggggtcaccgcgatccacggcctcaagaccggc
gacgccaacggcccgctgaccaacagccgcaccggctcggtctacatcgtcaagcccaag
atgcacggccccgaggaagtcgccttcacctgcgagttgttcagccgcgtcgaagacgtg
ctgggcttgccgcagggcaccctcaaggtcggcatcatggacgaggaacgccgcaccacg
ctcaacctcaaggcgtgcatcaaggccgccgccgaccgggtggtgttcatcaacaccggg
ttcctggaccgcaccggcgatgagatccacacctcgatggaggccggcccgatgatccgc
aagggtgcgatgaagaacagcacctggatcaaggcctacgaggacgccaatgtcgacacc
ggcctggcggccggcttcaagggcagggcccagatcggcaagggcatgtgggccatgacc
gaactgatggccgacatggtcgagcagaagatcggccagcccaaggccggggccaccacc
gcgtgggtgccctccccgacggccgccaccctgcacgcgatgcactaccactacgtcgac
gtgggcgccgtccaggaggagctcgcgggccagaagcgcaccaacatcgacgagttgctg
accatcccgctggccaaggaattggcctgggccccggaggaagtgcgcgaagaactcgac
aacaactgtcagtccatcctcggctacgtggtgcgctgggtggagcagggtgtcggctgc
tcgaaggtgcccgacatccacaacgtcgcgctgatggaggaccgcgccacgctgcggatc
tccagccagctgctggccaactggctgcgccacggcgtgatcaccgaggaggacgtgcgg
gccagcctggagcggatggcgccgctggtggaccagcaaaacgccggtgacgcggcgtac
cgggcgatggcgccgaacttcgacgacagcatcgcgtttgccgccgcgcaggagctgatc
ctgtccggcggtcggcagcccaacggctacaccgagccgatcctgcatcggcgccgtcgc
gaattcaaggctcgcgcgcgcgactga

DBGET integrated database retrieval system