KEGG   Mycobacterium shigaense: MSG_04519Help
Entry
MSG_04519         CDS       T05717                                 

Gene name
bphI-2
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase 2
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mshg  Mycobacterium shigaense
Pathway
mshg00360  Phenylalanine metabolism
mshg00362  Benzoate degradation
mshg00621  Dioxin degradation
mshg00622  Xylene degradation
mshg01100  Metabolic pathways
mshg01120  Microbial metabolism in diverse environments
mshg01220  Degradation of aromatic compounds
Module
mshg_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mshg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MSG_04519 (bphI-2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSG_04519 (bphI-2)
   00622 Xylene degradation
    MSG_04519 (bphI-2)
   00621 Dioxin degradation
    MSG_04519 (bphI-2)
Enzymes [BR:mshg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MSG_04519 (bphI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: BAX94634
UniProt: A0A1Z4ENQ1
Position
complement(4775601..4776662)
Genome map
AA seq 353 aa AA seqDB search
MSIDGIFFDPVWDVRMTDTSLRDGSHHKRHQFSADEVAAIVAALDAAGVPVIEVTHGDGL
GGSSFNYGFSKTPEQELIKLAAQTAKDAKIAFLMLPGVGTKEDIKEAQDNGGSICRIATH
CTEADVSIQHFGLARELGLETVGFLMMAHTIAPEKLAAQARIMADAGCQCVYVVDSAGAL
VLDGVADRVSALVAELGEDAQVGFHGHENLGLGVANSVEAVRAGAKQIDGSVRRFGAGAG
NAPVEALIGVFDKIGVKTGIDFFDIADAAEDVVRPAMPAECVLDRNALIMGYSGVYSSFL
KHAVRQGQRYGVPAHELLHRAGQRKLIGGQEDQLIDIALEIKHEQENSPAQAH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgacggcattttctttgacccggtgtgggatgtgcggatgaccgatacgtcg
ttgcgtgatggcagccatcacaagcgtcaccagttcagcgccgacgaggtggctgcgatc
gtggcggcgttggatgcggcgggggtgccggtgatcgaggtgactcatggtgacgggttg
ggcgggtcgtcgttcaactacggtttttctaagactcctgagcaggagttgatcaagctg
gctgcgcagacggcgaaagacgccaagatcgcttttttgatgttgcccggcgtgggcact
aaggaagatatcaaagaggcgcaggacaacggcgggtcgatttgtcggatcgcgacgcat
tgcaccgaggctgatgtgtcgattcagcatttcgggttggcccgtgagctgggtttggag
actgtcgggtttttgatgatggcgcacaccattgccccggagaagctggctgctcaggcc
cggatcatggctgatgctggttgccagtgtgtgtatgtcgtggattcggccggggccttg
gtgctggacggggtggctgatcgggtgtcggcgttggtggccgagcttggtgaggacgcg
caggtggggttccacgggcatgagaacctcgggttgggggtggccaattcggtggaggcg
gtgcgtgcgggtgccaagcagatcgatggcagcgtgcgccgttttggggcgggtgcgggt
aacgcgccggtcgaggctttgatcggggtgttcgacaagatcggtgttaagactggtatt
gatttcttcgatatcgccgatgccgccgaagatgtggtgcgcccggccatgcccgctgag
tgtgtgctcgaccgcaacgcgctcatcatgggttactccggggtgtactcgagcttcctc
aagcatgcggttcgccagggtcagcgctacggtgtgccggctcatgagctgctgcaccgg
gccgggcagcgcaagttgatcggcggccaagaagaccagctcatcgacatcgcactggaa
atcaaacacgagcaggaaaacagcccagcacaagcacactga

DBGET integrated database retrieval system