KEGG   Methanobrevibacter smithii: Msm_0293
Entry
Msm_0293          CDS       T00539                                 

Name
(GenBank) cation transport ATPase, HAD family
Organism
msi  Methanobrevibacter smithii
SSDB
Motif
Pfam: Hydrolase E1-E2_ATPase Hydrolase_3
Other DBs
NCBI-ProteinID: ABQ86498
UniProt: A5UJX0
Position
complement(283970..286093)
AA seq 707 aa
MKYQVMYNNGTRIRVRSGQAAFTKKEGYGISSLLLENNFIKKVFTSHRNGSILIYYDDVK
NRDKVFAALDKITEDDLVEVEPDMYMSSNELTNNFWVSLSGMLVRRVLGKIVLPIPIRNL
LTVYRAIKYIWHALDSLTSFRVDVALLDGAAVTGSLLKRDFDPASSMMFLLSISDLLEDY
TLQKTKNTLKESLTLNIDTVWVVNEDGEEIQQPISQINKDDKIKVHMGDVIPVDGKVVDG
EGMVNEATMTGEPLAVHKMPGKTVHAGTVVEEGNLIVQVYSFDKETRLNKIINLIENSEE
LKADAQSKAEELADSIVPYSFLTTFLTYLITRDTTKALSVLMVDFSCALKLTTPLSVISA
MKEASDNRMMVKGGKFLEKYATADTIVFDKTGTLTNATPKVVDVISLGDYSRDEILRMSA
CIEEHFAHSIATAIVKQAEEEGLKHDEDHSEVEYIVAHGIATSYNGKRAVIGSRHFLFDD
EGVEISKEDEKLIDEKVCEYSVVYLAIDNKLEGIICINDPVRKEARDVIEELKKLGIENV
IMLTGDSESGAKSSAEALGITEYRSQVLPEDKASIVESLKEEGRTIIMVGDGINDSPALA
AADVSVSMKNSSDIAREVADVSLLSDNLYDLITLRKLSVGMLNKIDTNYHSIIGINGSLI
ALGMFGIITPSTSSLIHNLSTMLLGALSTRSVLKEPREIEVNVVETA
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaaataccaagtaatgtataataacggaactcgtatcagagttcgttcaggccaggct
gccttcaccaaaaaggagggttatggtatttcttcattgcttttagaaaataattttatt
aaaaaagttttcacatctcatagaaacggaagtattttaatctattatgatgatgttaaa
aacagagacaaagtctttgcagcacttgataaaataactgaggatgatttggttgaagtt
gaacctgacatgtacatgagttcaaatgagttaactaataatttttgggttagtttatca
ggtatgcttgtgagaagggtattaggtaaaattgtattgcctattccaattaggaattta
ttgactgtttatagagctattaagtatatatggcatgctttagacagtttaacaagtttc
agagtggatgttgctctacttgatggtgcagcagttaccggatcacttcttaaaagagat
ttcgatccggcaagttctatgatgtttttattatcaatttccgatttgcttgaagactac
acattacaaaaaacaaaaaatactttaaaagaaagtttaactttaaatattgatactgta
tgggtagtaaatgaagatggtgaggaaatacaacaacctatatcccaaattaacaaagat
gataaaattaaagttcatatgggtgatgtaatacctgtagatggtaaagttgttgacggt
gaagggatggttaatgaagcaaccatgactggagaaccattggctgtccataaaatgcct
ggaaaaacagttcatgcaggtactgttgttgaagaaggtaatctgattgttcaagtttat
tcttttgataaagaaaccagattaaataaaattataaatcttattgagaattcagaagaa
ttaaaagcagatgctcaaagtaaagctgaggaattggcagactctattgtgccatacagt
ttccttacaacattccttacttatctgataacaagggatactacaaaagcattgtctgtt
ttaatggttgatttctcatgtgcacttaaattaacaactccattatctgttatttcagca
atgaaagaagcttcagataataggatgatggttaaaggtggaaaattccttgaaaaatat
gcaactgcagatacaatagtgttcgacaaaacaggaactcttactaatgcaactccaaaa
gttgttgatgtaatttctcttggagattactccagagatgaaattttaagaatgtctgca
tgtattgaagagcattttgcacatagtattgctacggctattgtaaaacaggctgaagag
gaaggtctaaaacatgatgaagaccatagtgaagttgaatatattgtagctcatggtatt
gcaacaagttataatggcaaacgtgctgttataggaagcagacactttttatttgatgat
gaaggtgtagaaatatccaaagaagatgaaaaactcattgacgaaaaagtctgtgaatat
tcggttgtttatttggctattgataataaacttgaaggtatcatatgtattaacgaccct
gtaagaaaagaagctagggatgttattgaagagcttaaaaaattaggtattgaaaatgtt
atcatgttgactggagacagtgaaagtggtgcaaaaagcagcgctgaagcattgggcata
actgaataccgctcacaggtgcttcctgaagataaggccagtattgttgaaagtttaaaa
gaagaaggcagaactattattatggtcggagatggaataaatgattctcctgcattggct
gctgctgatgtgtctgtttcaatgaaaaactcttcagatattgccagagaagttgcagat
gtttctttattgtctgataatttatatgatttaataacacttagaaaattgagtgttggt
atgttaaataaaatagatactaattatcacagtataattggcattaacggttctttaata
gcactgggtatgtttggaattataactccatcaacatcttcattgatacataatttatca
actatgcttttaggagctttaagtacacgttctgtattaaaagaaccaagggaaatagaa
gttaatgtagtagaaactgcataa

DBGET integrated database retrieval system