KEGG   Methanobrevibacter smithii: Msm_0467Help
Entry
Msm_0467          CDS       T00539                                 

Definition
(GenBank) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
  KO
K19266  lactaldehyde dehydrogenase [EC:1.2.1.22]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00620  Pyruvate metabolism
msi01100  Metabolic pathways
msi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Msm_0467
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.22  lactaldehyde dehydrogenase
     Msm_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: ABQ86672
UniProt: A5UKE4
Position
complement(444931..446343)
Genome map
AA seq 470 aa AA seqDB search
MDMLINGKHISADDLAEVKNPYNGEVIDTVPVSHLNNVDLAIDAAVNAKDSIQEMSAFKI
SNKLYAVYEKLKDNKDELAELLTKEVGKPINESVVEVNRSIETLKLSAEEAKRIYGETVP
LDGGINGKGFFAFTQRVPLGVVAAITPFNYPLNLSIHKIAPAIACKNTVIIKPPINAPLT
VMKFAELVNEEFPDGVINTVTGYGSEVGDALVTSPKVDKISFTGSVATGLLIASRAGMKK
VTLELGGNDPLVVLKDADIDRAVNGVMNGAYLNAGQVCMGVKRIIVDESIADEFTQKLVR
ETKKIKMGDPMDKNTVLGTLIDEDAARMVEETVNNAVKAGAKILTGGKRDGAFYEATVLD
NVTPDMDVVVNETFGPVAPIIKVKSTDEAIKVANDTEYGLQAGVFTENFRDGLRCANEIE
AGTVFVNKQSTFRTDNMPFGGFKNSGTGKEGVKYAVEEMTKEKLIGLNLR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttaataaatggtaaacatatttcagctgatgatttggcggaagttaaaaat
ccatacaatggggaagttatagatacagttcctgtttcccatttaaataatgtggatttg
gctattgatgctgcagttaatgctaaagattctattcaggaaatgtctgcatttaaaatt
tcaaataaattatatgcagtttacgaaaaattaaaagataacaaagatgaattggctgaa
ttgcttacaaaagaggtaggtaaacctattaatgagtctgttgttgaagttaaccgttca
attgaaacattaaaactttcagcagaagaagctaaaagaatttatggtgaaacagttccg
ctggatggtgggataaacggtaaaggtttttttgcatttactcaaagggttccattaggt
gttgtagcagctataactccatttaattatcccctaaatttatcaattcataaaatagct
cctgctattgcatgtaaaaatactgtaattataaaacctccaataaatgcaccattgaca
gttatgaaatttgcagaacttgtaaatgaggagtttccagatggcgttatcaatactgta
acaggatatggttcagaagtaggtgatgcactggtaacatctcctaaagtagataaaatt
tcatttactggaagtgtagctaccggactgcttatagcttcaagagcgggaatgaaaaaa
gttactttggaattgggaggtaatgatcctcttgttgttctaaaggatgcggatattgac
agggcagttaacggagtaatgaatggtgcttatttaaatgccggacaggtatgtatgggc
gttaaaaggattattgttgatgagtcaatagctgatgagtttacgcaaaaattggttagg
gaaactaaaaaaatcaaaatgggtgatcctatggataaaaacacagtattgggaacactt
attgatgaagatgctgctcgcatggttgaagaaacagttaataatgcagttaaggcaggt
gccaaaatactgactggtggaaaaagagacggtgcattttacgaagctacagtactggat
aatgtcactccggatatggatgttgttgtaaatgaaacattcggtccagttgcaccgatt
ataaaagtaaaatcaactgatgaagctattaaagtagctaatgatacagaatatggtctt
caggcaggagtatttactgaaaactttagagatggattaaggtgtgcaaatgaaattgag
gcaggtacggtttttgtaaataaacaatctacattcagaactgataacatgcctttcgga
ggatttaaaaatagtggaacaggaaaagaaggagtaaaatatgcagtagaagaaatgact
aaggaaaaattaataggattaaatttaaggtag

DBGET integrated database retrieval system