KEGG   Methanobrevibacter smithii: Msm_0615Help
Entry
Msm_0615          CDS       T00539                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00010  Glycolysis / Gluconeogenesis
msi00030  Pentose phosphate pathway
msi00051  Fructose and mannose metabolism
msi00680  Methane metabolism
msi01100  Metabolic pathways
msi01110  Biosynthesis of secondary metabolites
msi01120  Microbial metabolism in diverse environments
msi01130  Biosynthesis of antibiotics
msi01200  Carbon metabolism
msi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0615
   00030 Pentose phosphate pathway
    Msm_0615
   00051 Fructose and mannose metabolism
    Msm_0615
  Energy metabolism
   00680 Methane metabolism
    Msm_0615
Enzymes [BR:msi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Msm_0615
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Msm_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABQ86820
UniProt: A5UKU2
Position
complement(583981..585075)
Genome map
AA seq 364 aa AA seqDB search
MKTTVSVIKADIGSVSGHCVAHPDLMDICDEVLAEALETNILTDYYISRCGDDIDLIMTH
RNGEENEEVHETAYNAFMKATERARELKLYGAGQDLLSDTFSGNIKGMGPGVAEMEFKER
PSDPVLVYCCDKTEPGAFNLPIFKMFADPFNTAGLVIDPSLHDGFKFEVFDVIEHRKVIL
NCPEEMYDLLALIGSTGRYVIKRVWKKNGEIAAAISTERLNLMAGEYVGKDDPAAIVRAQ
SGFPANGECVEPFAFPHMVSGWMRGSHNGPMMPVSERDANPIRFDGPPRVIGLGFQVSDA
KLIGPVDLFDDPAFDPTREESARIATYIRRHGPFEPHRLPAEEMEYTSLPGVMAKLEDRF
EDME
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaactgttagtgtaattaaagctgatattggaagtgtgtctggacattgtgta
gcacacccagatttaatggatatttgtgatgaagttttagcagaagctttagagacaaat
attttaactgattattatatctcccgttgtggagacgacattgacttgattatgactcat
agaaatggggaagaaaacgaagaagttcacgaaactgcttacaatgctttcatgaaagct
actgaaagagcacgtgaattaaaattatacggtgcaggtcaagatttattatctgacacc
ttttctggaaacattaaaggtatgggtcctggtgttgctgaaatggaattcaaagaaagg
ccaagtgaccctgttttagtatactgctgtgacaaaaccgaacctggtgcatttaactta
cctatttttaaaatgttcgcagatccatttaacactgcaggtcttgttattgacccaagt
ttacatgatggattcaaatttgaagtatttgatgtaattgaacacagaaaagttatctta
aactgtcctgaagaaatgtacgatttactcgcattaatcggttctactggaagatacgta
attaaaagagtatggaagaaaaacggagaaatcgcagcagctatcagtactgaaagatta
aacttaatggctggagaatacgttggtaaagatgaccctgcagctattgtaagagcacaa
tctggtttcccagctaatggtgaatgtgtagaaccatttgcattccctcacatggtaagt
ggatggatgagaggttcccacaacggtcctatgatgcctgtatctgaaagagatgcaaac
ccaattagatttgacggaccacctagagtaatcggtttaggtttccaagtatctgatgct
aaattaataggtcctgttgacttatttgatgaccctgcatttgatcctactagggaagaa
tctgcaagaatcgctacctacatcagaagacacggtccatttgaacctcacagattacct
gctgaagaaatggaatatacttcattacctggtgtaatggcaaaactcgaagatagattc
gaagatatggaataa

DBGET integrated database retrieval system