KEGG   Methanobrevibacter smithii: Msm_0765Help
Entry
Msm_0765          CDS       T00539                                 

Definition
(GenBank) pyruvate carboxylase (acetyl-CoA/biotin carboxylase), subunit A, PycA
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00020  Citrate cycle (TCA cycle)
msi00620  Pyruvate metabolism
msi00720  Carbon fixation pathways in prokaryotes
msi01100  Metabolic pathways
msi01120  Microbial metabolism in diverse environments
msi01200  Carbon metabolism
msi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msm_0765
   00620 Pyruvate metabolism
    Msm_0765
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msm_0765
Enzymes [BR:msi01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Msm_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 GARS_A RimK ATP-grasp ATP-grasp_5 ATPgrasp_ST ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ABQ86970
UniProt: A5UL92
Position
724646..726139
Genome map
AA seq 497 aa AA seqDB search
MFEKILIANRGEIAIRVMRACRELDIQSVAIYSDADTTSLYTNYADESYPLGNPSPAKSY
LNIEKIIDIALESGSDAIHPGYGFLAENPKFGEACEKNGIKLIGPTGDVIHQMGDKITSK
ALMKKAGVPVIEGTPEGVSDIEEAKEIARQIGYPVIVKASAGGGGIGMRAVYEEDELVRA
IESTQSVASTNFGDSTVFIEKYLEKPRHIEFQLLADEHGNVIHVADRECSIQRRHQKLLE
EAPSPIMTEELRAEMGASAVKAAEYIGYTSAGTVEFLYDNGQYYFLEMNTRIQVEHPITE
LVTNTDLIKEQIKIANGDELSYEQKDIQVSGHAIECRINAEDPLNDFAPNPGKITGYRSP
GGPGVRLDSGVYMNYTIPTFYDSMISKLVTWGRTRDDSIARMKRALSEYIILGVKTTIPF
HKAILRNPNFISGDLNTHFIDQYKNGIESEMVNVIAEDLENVNKMKSTFMPSKKIAAISA
AVGSYLNTAKNQQMNKK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaagatattaattgcaaatagaggagaaattgcaataagagttatgcgtgcc
tgtcgtgagcttgatatccaaagcgtagctatatactctgatgcagatacaacatctctt
tatacaaactatgctgatgaaagctatcctttaggtaacccttctccagccaagtcttat
ttaaatatagaaaaaatcatagatattgcacttgaatccggatcagatgctattcaccca
ggatatggatttttagctgaaaaccctaaatttggtgaagcatgtgaaaaaaatggaatt
aaacttataggacctacaggtgatgtaatccatcaaatgggagataaaataacttcaaaa
gctcttatgaaaaaagctggagttcctgttattgaaggtactcctgaaggagttagtgac
attgaggaagctaaagaaatagccagacaaattggatatcctgtaattgtaaaagcttct
gcaggtggtgggggaattggtatgcgtgctgtttatgaagaagatgaattagtacgtgca
attgaatctacccagtctgttgcttctacaaactttggagactcaactgtatttattgaa
aaataccttgaaaaacctagacacatcgaatttcagttattggctgatgaacatggaaat
gttattcatgtagcagacagggaatgttccatccaaagaagacatcaaaagttacttgaa
gaagctccttctccaattatgactgaagagcttagggctgaaatgggagcaagtgcagta
aaagctgcagaatatatcggctataccagtgcaggtactgttgaattcctgtacgacaac
ggccaatattacttccttgaaatgaacacacgtattcaggtagaacacccaattacagaa
cttgttaccaatactgatttgattaaagaacaaataaaaatagctaatggtgatgaactc
agttacgaacaaaaggacatacaagtatcaggtcatgcaatagaatgtcgtattaatgca
gaagacccgttaaatgactttgcacctaaccctggtaaaattaccggttacaggtctcct
ggaggacctggtgtacgtttagacagtggagtttatatgaattataccattcctactttc
tatgattcaatgatttcaaaattagtaacctggggaagaaccagagacgactccatagcc
agaatgaaaagagcattaagcgaatacattattttaggagttaaaactacaattccattc
cataaagctatcttaagaaatcctaactttatcagcggtgacttaaacactcactttatt
gaccaatacaaaaacggtattgaaagtgaaatggttaatgtaattgcagaagatttggaa
aatgtaaataaaatgaaatccactttcatgccaagtaaaaaaatagctgcaatttctgct
gctgttggatcttacttaaatactgctaaaaaccaacaaatgaataaaaaataa

DBGET integrated database retrieval system