KEGG   Methanobrevibacter smithii: Msm_1142Help
Entry
Msm_1142          CDS       T00539                                 

Definition
(GenBank) tryptophan synthase, beta subunit, TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00260  Glycine, serine and threonine metabolism
msi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msi01100  Metabolic pathways
msi01110  Biosynthesis of secondary metabolites
msi01130  Biosynthesis of antibiotics
msi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msm_1142
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msm_1142
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msm_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI PALP
Motif
Other DBs
NCBI-ProteinID: ABQ87347
UniProt: A5UMB9
Position
complement(1120245..1122026)
Genome map
AA seq 593 aa AA seqDB search
MVKIKICGLKRLEDIELANRYKIDYAGFVFAESKRKVNYDLAKQMKEKLCEDIQSVGVFV
DAGTDEILKLYNDGIIDVAQLHGMESEDYIKTLKEKTDYKLKIIKAIEVSENTDLSKYDD
SLADYLLLDSGKGSGKTFDWHLIRKDLKKEFFLAGGLNSKNITQAIGEFKPYAIDLSSGV
ESDGFKDENKIKKVMEAKNMNNGRYGEYGGQYISETLMNELIYLEEQYYHYMNDSEFVEE
LNTLLKEYAGRPSLLYYAKRMTEDLGGAKIYLKREDLNHTGAHKINNVLGQVLLAKKMGK
TRVIAETGAGQHGVATATAAALLDMECEVYMGELDTKRQALNVYRMELLGAKVHPVKSGT
KTLKDAVNDAFRDWIGRVHDTNYVIGSTMGPHPFPMMVRDFQAVISAEAREQFLEKEGKL
PDAVLACVGGGSNAMGAFYNFIDDADVKLIGCEAGGKGVDTPYNAAALTNGQIGIFHGMK
SIFNQGEYGQISEVYSVSAGLDYPGVGPEHAYLRDIKRAEYVPVTDEEAVNAFEYLSKME
GIIPAIESAHAVAHAMKIAPKMDKDEIIMVCLSGRGDKDVASIAKYRGVELNE
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaattaaaatctgcggacttaaaagactggaggatattgaacttgcaaacagg
tataaaatagattatgcaggttttgtatttgctgagagcaaaagaaaagtaaattatgat
cttgcaaaacaaatgaaggaaaaactctgcgaagatattcaaagtgttggtgtttttgta
gatgcaggcactgatgaaatcctaaaattatacaatgatggtataattgatgtggcacag
cttcatggaatggaaagcgaagattatattaaaactttgaaagaaaaaacagattataag
ttaaagattattaaagctattgaagtatctgaaaatacggatttgtctaaatatgatgat
tcattagctgattatttgttgcttgacagtggaaaaggatcggggaaaacctttgactgg
catttgattagaaaagacttgaaaaaagaattctttttggcaggaggattaaatagcaaa
aacatcactcaggctattggagaatttaagccatatgcaattgatttaagcagcggtgtt
gaaagtgacggatttaaagatgaaaataaaataaaaaaagtcatggaggctaaaaacatg
aataatggaagatacggggaatatggaggacaatatatctctgaaactttaatgaatgaa
ttgatttacttggaagaacagtattatcactatatgaatgattctgaatttgtagaagaa
ttaaatacacttttaaaagaatatgctggcagaccttctttattatactatgcaaaaaga
atgactgaagatttgggaggagctaagatttatttaaagcgtgaagatttaaatcacact
ggagctcataaaatcaacaatgtgcttggtcaggttttactggctaaaaaaatgggaaaa
acaagagtaatagctgaaactggagcaggccaacatggggtagctacagcaacagcagca
gcacttctggatatggaatgtgaagtgtacatgggtgagttagataccaaacgtcaggct
ttaaatgtttataggatggaattgcttggagcaaaagttcatccggtaaaatcaggaaca
aaaacactaaaggatgcagttaatgatgcatttagagattggattgggagagttcatgat
acaaattatgtaataggttcaacaatggggccgcatccttttccaatgatggttagagac
ttccaagcagtaataagtgctgaagctcgtgaacaatttttggaaaaagaaggaaaactt
ccggatgcagttttagcatgtgttggtggtggaagtaatgcaatgggagcattttacaat
ttcatagatgatgcggatgttaaattaattggatgtgaagcaggaggaaaaggagtagat
actccttataatgcagcagctttaactaatgggcaaatcggaatatttcacggaatgaaa
tcaatatttaatcagggagaatatgggcagatatctgaagtctattctgtctcagcaggt
ctggattatcctggagtaggacctgaacatgcatatttaagagatattaaaagagcagag
tatgttcctgttacagatgaagaagcagtcaatgcttttgaatacttgtcaaaaatggaa
ggaatcattccggctattgaaagtgctcatgcagtagcacatgcaatgaaaatagctcca
aaaatggataaagacgaaattatcatggtttgtctttctggaaggggagacaaagatgta
gcatcaattgcaaaatataggggagttgagttaaatgagtaa

DBGET integrated database retrieval system