KEGG   Methanobrevibacter smithii: Msm_1263Help
Entry
Msm_1263          CDS       T00539                                 

Definition
(GenBank) aspartate carbamoyltransferase, PyrB
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00240  Pyrimidine metabolism
msi00250  Alanine, aspartate and glutamate metabolism
msi01100  Metabolic pathways
Module
msi_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Msm_1263
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msm_1263
Enzymes [BR:msi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Msm_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABQ87468
UniProt: A5UMP0
Position
1267541..1268491
Genome map
AA seq 316 aa AA seqDB search
MIKIFELKSIISIKDFERKDIDYILDEASKLEDIAKSKECCDELKGKILGLMFFEPSTRT
RLSFETSMKRLGGNCIGIENTRSCSVSKGESIADTAKMFEGYSDALVIRHELEGVSKFIS
DIVDVPVINAGDGAGQHPTQTLLDLYTIKKELGQIDNLKIALVGDLKFGRTVHSLSNALG
LYDNVELYFVAPKELRMPQEVLHDLNKKNIPYTEVDSIEEIIDKVDVLYVTRIQKERFGD
LDEYLKIKGAYIVNKKMLEGKDVIVMHPLPRIDEIATDLDNTKHNKYFNQAFNAVPVRMA
ILKTLIKNNPKWNHIE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaaatttttgaattaaaaagtataatttcaataaaagattttgaaagaaaggat
attgattatattctagatgaagcatcaaaactagaagatatagctaaatcaaaagaatgc
tgtgatgaattaaaaggtaaaatccttggattgatgttttttgaaccgtcaacaagaaca
agattatcttttgaaacatctatgaaacgtttaggtggaaactgcataggtattgaaaat
acaagatcatgttctgtttccaaaggggaaagcatagctgacactgcaaaaatgtttgag
ggttacagtgatgctttagttattagacatgaattagaaggcgtatccaaattcatatca
gatattgttgatgttcctgtgataaatgctggagacggtgctggtcagcatcctacccag
acattacttgatttatacactatcaaaaaagaattagggcaaattgataacttaaaaata
gctttagtcggtgatttaaaatttggtcgtacagtacattccctgtccaatgcattggga
ttatatgataatgtggaactttattttgtagctcctaaagaattaagaatgcctcaagag
gttttacacgatttaaacaaaaaaaatattccatatactgaagttgatagtatagaagaa
attattgataaagtagatgttttatatgtaaccagaatccaaaaagaacgttttggagat
ttagatgaatacttaaaaataaaaggagcttatattgttaataaaaaaatgttagaaggt
aaggatgttattgttatgcacccattaccaagaattgatgaaatagctactgatttagat
aacaccaaacataacaaatatttcaatcaagcatttaatgctgttccagttagaatggcc
attttaaaaactttaataaaaaacaatcctaaatggaatcatattgaataa

DBGET integrated database retrieval system