KEGG   Methanobrevibacter smithii: Msm_1565Help
Entry
Msm_1565          CDS       T00539                                 

Definition
(GenBank) cobyric acid synthase, CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00860  Porphyrin and chlorophyll metabolism
msi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msm_1565
Enzymes [BR:msi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Msm_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB GATase SNO SRP54
Motif
Other DBs
NCBI-ProteinID: ABQ87770
UniProt: A5UNJ2
Position
complement(1600799..1602379)
Genome map
AA seq 526 aa AA seqDB search
MTNIFKANKKVILMVKCLMVQGTSSNAGKSMLVAALCRIYKNRGYNVAPFKSQNMSLNSY
TTKENGEIGIAQMLQAEAAMVEPSVHMNPILLKPKGDFTSNVIIQGKSIGDMNFYQYQHD
YHNTAFEAIQESFNILKEKYDIIIIEGAGSPAEINMRKEDLANMEIAHMADANVILIADI
EMGGVFAAIAGTYVLLDDYDRSRLKATVINKFRGNLDILKPGLDRIEEITEAPVLGVLPY
DETLKLPEEDSASLTTHIFDENKDIIIGVIRLPKISNFTDIDPFEFEEDVGIKMINPNDE
IGNVDAIIIPGTRNSTKDAKELFDSGLASKIIAKSDEIPVVGICGGYQILGNIIYDENKK
ESDVGTIEGLKLLDIESKFQHTEKIVTQSEAVIPQKEDLSGIAGEIFAKIAGEKVTGYEI
HEGTSHLNSSKDVCPLLNVQKGQGNNDEGDFDGACNGNVFGTYFHGIFHNYNFRREFLNY
LRVKKGLEAKYGEDPYETQKDYSLNKLAQIVEENIDMEIIDELLFS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatatttttaaagcaaataaaaaagtgattttaatggttaaatgtttaatggtt
cagggaacatcatcaaatgcaggaaaaagtatgcttgtagctgcattatgtagaatatat
aaaaacagaggctataacgtagctccttttaaatctcaaaatatgtctttaaattcatat
acaactaaagaaaacggagaaataggaatagctcaaatgttgcaagcagaagctgcaatg
gttgaaccaagtgtacatatgaaccctattcttttaaaaccaaaaggtgattttacatcc
aatgtaattattcagggaaaatccatcggagatatgaatttctaccagtatcagcatgac
tatcacaacacggcttttgaagctattcaggaaagtttcaatattttaaaagaaaaatac
gatattataatcattgaaggagcaggatcacctgcagaaattaatatgcgtaaagaagac
cttgccaatatggaaattgcacatatggctgatgcaaatgttattttaatagctgatatt
gaaatgggtggtgtttttgcagctattgccggaacatatgtgcttttagatgactatgac
agatccagactgaaagctactgtcatcaataagtttagaggaaatttggatattttgaaa
cctggacttgacagaattgaagaaatcaccgaagctccggttttaggtgttcttccttat
gatgaaacattaaaactgcctgaagaagactcagcatccctaacaacccacatatttgat
gaaaataaggatattattattggagttataaggcttcctaaaatctccaattttacagac
attgatccttttgagtttgaagaggatgttggaattaaaatgattaatcccaatgatgaa
attggaaatgttgatgctataatcattcccggaacacgtaattcaaccaaagatgcaaaa
gaactctttgacagcggacttgcaagtaaaataatagccaaatccgatgaaatcccagtt
gttggaatctgtggaggatatcaaatccttggaaatataatttatgatgaaaataaaaaa
gaatctgatgttggaactattgaagggttaaaattattggatattgagtcaaaattccag
cataccgaaaaaattgtaacacagtctgaagcagttatacctcaaaaagaggatttgtcc
ggaatagctggtgaaatatttgcaaagattgctggagagaaagtaaccggttatgaaatc
catgaaggtacatcacacctgaattcaagtaaagatgtatgcccattattaaatgttcaa
aaaggacagggaaataatgatgaaggtgactttgacggagcatgtaatggaaatgtcttt
ggaacatacttccatggaatattccacaattacaatttcagacgtgaatttttaaattat
ctaagagtcaaaaaaggtcttgaagcaaaatatggtgaagacccttacgaaacacaaaaa
gattactcattaaataaattagcacaaattgttgaagaaaatatagatatggaaattatt
gacgaacttcttttttcataa

DBGET integrated database retrieval system