KEGG   Methanosarcina siciliae C2J: MSSAC_3362Help
Entry
MSSAC_3362        CDS       T03863                                 

Definition
(GenBank) Nitrogenase (vanadium-iron) alpha chain
  KO
K22896  vanadium-dependent nitrogenase alpha chain [EC:1.18.6.2]
Organism
msj  Methanosarcina siciliae C2J
Pathway
msj00910  Nitrogen metabolism
msj01100  Metabolic pathways
Module
msj_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:msj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MSSAC_3362
Enzymes [BR:msj01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.2  vanadium-dependent nitrogenase
     MSSAC_3362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: AKB37952
UniProt: A0A0E3PQ58
Position
4146328..4147449
Genome map
AA seq 373 aa AA seqDB search
MFGAEKQLKKAIMEAFQEFPEIKRMFVYTTCTTALIGDNPKAVCREVQEELEDVDIFVVE
CPGFAGVSQSKGHHELNIGWMRDKIGTLEPEITSEYTINVIGDYNIQGDTYVLQKYLDKM
GIQVIAHFTGNVTYDQLRCMHRAKLNVVNCARSAGYIANELKRVYDIPRMDVDTWGFEYV
KVALRKIGAFFGLEDKAEEVIAEEVAKYEGKLDWYKERLKGKQICIWTGGPRLWHWTKAL
EDDLGMEVVAMSSKFGHQEDFEKVIARGRIGTIYIDDGNELEFFEVLDNIHADLIFTGPR
VGDLVKKLHIPYINGHAYHNGPYMGFEGAVNMARDMYNAIYSPMWKLAGKDPRETDSPMW
SLTEKDSGVVQES
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggcgctgaaaagcagctgaaaaaagcaataatggaagctttccaggaatttccg
gaaattaagagaatgtttgtctatacaacctgcacaaccgcactcataggagataatcct
aaagctgtatgccgtgaagttcaggaagagcttgaagatgtcgatatattcgttgtcgag
tgtcctggctttgccggggtcagccagtcgaaaggacaccatgagctaaatattggctgg
atgagggataaaataggcacgcttgaacctgaaatcacaagcgaatacacgattaatgtc
attggcgactacaatattcagggagatacttacgtcctgcaaaaatatcttgacaaaatg
ggtatccaggttatcgcacacttcaccgggaatgtaacctatgaccagctgcgctgcatg
catagagcaaagctgaatgttgtcaactgtgctcgttctgccggatatatagctaacgaa
cttaagagagtatatgacatccctagaatggatgttgatacctggggttttgaatacgtc
aaagtagccttgagaaagatcggggctttctttggactggaagataaggctgaagaggta
attgcagaagaagttgcaaaatacgaaggaaagcttgactggtataaggaacggctcaaa
ggaaagcagatctgtatctggaccggtggtccaagactctggcactggacaaaggctctt
gaagatgatctgggtatggaagttgttgccatgtcctccaaatttgggcatcaggaggac
tttgaaaaagttattgccagaggcaggatagggaccatctatatcgatgatgggaacgag
cttgaattcttcgaggtgctagataatatccatgccgatctgatttttaccgggccgagg
gttggagacctcgtcaaaaaactgcatattccatacattaacggacatgcgtatcacaat
ggtccttacatgggttttgaaggagcagtaaacatggcgagagacatgtataacgcgata
tattccccgatgtggaagttagccggaaaagatcccagagagacagattcccctatgtgg
agtttaactgaaaaagattctggtgtggtgcaggagtcatga

DBGET integrated database retrieval system