KEGG   Methylocella silvestris: Msil_0541Help
Entry
Msil_0541         CDS       T00802                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
msl  Methylocella silvestris
Pathway
msl00450  Selenocompound metabolism
msl00970  Aminoacyl-tRNA biosynthesis
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Msil_0541
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Msil_0541
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msl01007]
    Msil_0541
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msl03016]
    Msil_0541
Enzymes [BR:msl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Msil_0541
Amino acid related enzymes [BR:msl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Msil_0541
Transfer RNA biogenesis [BR:msl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Msil_0541
 Prokaryotic type
   Other AARSs
    Msil_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACK49513
UniProt: B8ELC4
Position
complement(600711..602270)
Genome map
AA seq 519 aa AA seqDB search
MSAPTFYITTAIPYANGAPHIGHAYERIATDAIARFKRLDGYETLFVTGMDEHGQKMQQT
AARENLSPLQLADRTAAQFYAMGELLNASADDIVRTTEARHHAASQEIWKRMQASGDIYL
SKYPGWYSVRDEAFFDDSELTDGPGGSKLAPTGAPVEWVEEESYYFRLSAYQERLLALYR
ERPDFVTPEKYRNEIVAFVERGLTDLSISRSTFDWGVPVPGDPKHVMYVWVDALTNYITG
TGFPDAASPRAKFWPADAHVIGKDITRFHAIYWPAFLMSAGLLVPKQIVTHGFLFNRGEK
MSKSIGNVIDPFALAKEYGVDPFRYFLLREVPFGQDGNYSHEAIVNRTNADLANDLGNLA
QRSLSMLAKNCGGVLPSSPALNETDEALLFQARALPQKARGHMRDYALHLILAEIWRVVG
EANRYFATEEPWVKRKTDPARMESVLYVTVEVLRIIAIMTQPFMPASMERLLDSLGVAKD
ARSFADAENFILRAPSGPLPAPTPVFPRYVEADDAPAPA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgactttctacatcacgaccgcgattccctatgccaatggcgcgccccat
atcgggcacgcttatgagcggatcgcgaccgacgccattgcccgcttcaagcggctcgac
ggctacgagacgctgttcgtgaccggcatggacgaacacggccagaaaatgcagcagacc
gccgcacgcgagaatttgagcccgctacagttagcggaccgcacggcggcgcaattctac
gcgatgggcgaattattgaacgcgtccgccgacgatattgtgcgcacgaccgaggcgcgc
catcacgccgcctcgcaggaaatctggaagcggatgcaggcgtcgggcgacatttatctg
tcgaaatatcccggctggtattcggtgcgggacgaagcctttttcgatgactccgagctg
acggacgggccgggcggatcgaagctggcgccgaccggcgcgccggtcgaatgggtcgag
gaagagagctattactttcggctgtcagcctatcaagagaggctgcttgcgctttatcgc
gagcgcccggatttcgtgacgccggagaaatatcgcaatgaaatcgtcgccttcgtcgag
cgcggtctgaccgatctgtcgatcagccgttcgactttcgactggggcgttcccgtgccg
ggcgatccgaaacatgtgatgtatgtctgggtcgacgcgctgaccaattacatcacgggg
accggttttcccgacgccgcctcgccccgcgcgaaattctggccggccgacgcgcatgtg
atcggcaaggatatcacccgcttccatgcgatttactggccggcgttcttgatgtccgcc
ggactgctggttccaaagcagatcgtcacgcatggatttctgttcaaccgcggcgagaaa
atgtcgaagtcgatcggcaatgtgatcgaccccttcgccctcgccaaggaatatggcgtc
gatccgttccgctatttcctgctgcgcgaagttccgttcgggcaggacggcaattattcg
catgaggcgatcgtcaaccgcaccaacgccgatctcgccaatgatcttggcaatctggcg
cagcgctcgctatccatgctcgccaagaattgcggcggcgtgttgccgtcgtccccggcg
ctgaacgagacggacgaggcgctcctgtttcaggcgcgggcgctgccgcagaaggcgcgc
gggcatatgcgagactatgcgctgcatctgatcctcgccgaaatctggcgcgtggttggc
gaggccaatcgttattttgcaacggaagagccctgggtgaagcgcaagaccgatccggcg
cgaatggagagcgtgctctatgtgactgttgaggtcttgcgtatcatcgcgatcatgacg
cagccctttatgcccgcctcgatggagaggcttctggacagtcttggcgtcgccaaggac
gcgcgcagcttcgccgacgcagagaactttattctacgcgcgccgtccggtccgttgccg
gcgccgacgccggtgtttccgcgttatgtcgaggcggacgacgcgccggcgccggcttga

DBGET integrated database retrieval system