KEGG   Methylocella silvestris: Msil_0953Help
Entry
Msil_0953         CDS       T00802                                 

Definition
(GenBank) peptidase S1 and S6 chymotrypsin/Hap
Organism
msl  Methylocella silvestris
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ_6 PDZ Peptidase_S46 Tricorn_PDZ Peptidase_S32
Motif
Other DBs
NCBI-ProteinID: ACK49922
UniProt: B8EJX5
Position
1038283..1039302
Genome map
AA seq 339 aa AA seqDB search
MDYFTSFVLDESEPAPQDDAAALTRDFPADDGALLDAYSKSVTRIVEEVGPSVVRLDVKR
GDGRSGGSGSGVIVSPDGLILTNSHVVGGARRATVTTLDGRNLSGRVLGDDPDTDLALVR
VDENVTLPAARLGDSKRLKPGEIAVAIGNPLGFDSTVTAGVISALGRSLRSNNGRMIDDV
IQTDAALNPGNSGGPLVASNGAVIGVNTAIIAGAQGICFAVAANTARFVLGELVAHGRVR
RAYLGVGASTIVLPRRIALRLGLEQTTGAVISQVEKDGPADHAGLLTGDIVLAVDGAPVA
SAGDLLRLLGADKINQVAPLDILRRSDRRRFWAALRERV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggactatttcacttcctttgtgctcgatgaatccgagcctgcgccgcaggatgacgcg
gccgcgctgacacgcgatttccccgcggatgacggggcgctgctcgacgcctattcgaaa
agcgtgacgcgcatcgtcgaggaggtcggcccgagcgtcgtgcggctcgacgtcaagcgc
ggggacggccgcagcggcggctctggctccggcgtcatcgtctcgccggacgggctcatc
ctgaccaacagccatgtcgtcggcggcgcgcgccgcgcaaccgtgacgacgctggacggg
cgcaatctgtccggccgggtccttggcgatgatccagacaccgacctcgccttggtgcgg
gtcgatgagaacgtcactttgccggcggcgcggctcggcgattcgaaacggctgaagccg
ggtgaaatcgcggtcgccatcggcaatccgctcggcttcgattcgaccgtgacggcgggc
gtcatttcggcgctcgggcgttcgctgcgctcgaacaatggccgcatgatcgacgatgtg
atccagaccgacgccgcgctcaatcccggcaattccggcggaccgctggtcgcctcgaac
ggcgccgtcatcggcgtcaacaccgcgatcatcgctggcgcgcagggcatctgctttgcg
gtcgcagcgaatacggcgcgtttcgttcttggcgaactcgtcgcccatggccgcgtgcgc
cgcgcttatctcggcgtcggcgccagcacgatcgtcctgccgcgccgcatcgcgctccgg
ctcggcctcgagcagaccacgggcgcggtgatcagccaggtcgaaaaggatggccccgcc
gatcacgcgggcctgcttacgggcgatatcgtccttgccgtcgatggcgcgccagtcgcc
agcgctggcgatcttctgcgcttgcttggcgccgacaagatcaaccaggtcgcgccgctc
gatattctgcggcgctccgaccggcgccggttctgggccgcgctgcgcgagcgcgtttga

DBGET integrated database retrieval system