KEGG   Methylocella silvestris: Msil_1023Help
Entry
Msil_1023         CDS       T00802                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
msl  Methylocella silvestris
Pathway
msl00270  Cysteine and methionine metabolism
msl00920  Sulfur metabolism
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Msil_1023
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Msil_1023
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Msil_1023
    2.3.1.46  homoserine O-succinyltransferase
     Msil_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ACK49992
UniProt: B8ELJ8
Position
1109882..1111066
Genome map
AA seq 394 aa AA seqDB search
MTIVLTHKLSGLREVDAPHSLVAHFGPDHALQMDSGGRLNQWTIAYQTYGELNAAKSNAI
LVCHALTGDQHVANAHPVTGKPGWWSTMVGPGRPIDTDRYFVICSNVIGGCMGTTGPASL
NPQTGRPYGLELPIVTIRDMVRAQAMLIDHLGVDTLFCVVGGSMGGMQVLQWVASFPERV
FSAMPIATAAKHSSQNIAFHEVGRQAVMADPDWRKGRYLEEGVIPTKGLAVARMAAHITY
LSDEALQSKFGRKLQDRDAPTFSFDAEFQIENYLRYQGSSFVDRFDPNSYLYVTRACDYF
DLAADYDGSLARAFQGVKARFCVVSFNSDWLYPTAASRAIVHALNAGGASVSFVDIETDR
GHDAFLLDLPEFIATSQGFLDSAAKARGLPPAAP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatcgtcttgacccataagctcagcggcctgcgcgaagtcgacgcgccgcatagt
ctcgtcgcgcatttcggaccagatcacgcgctgcagatggattcgggcggccggctcaat
caatggacgatcgcctatcagacctatggcgaactcaacgccgccaaatccaacgccatt
ctcgtctgccatgctctgaccggcgatcagcatgtcgccaacgcgcatccggtaacgggc
aagcccggctggtggagcaccatggtcggtcccggccggccgatcgacaccgatcgctat
ttcgtcatctgctcgaatgtgatcggcggctgcatgggcacgaccggtccggcctcgctc
aatccgcagacaggccggccgtacgggcttgagctgccgatcgtgacgatccgcgacatg
gtccgggcgcaggcgatgctgatcgaccaccttggcgtcgatacgctgttttgcgtcgtc
gggggctcgatgggcggcatgcaggtgctgcaatgggttgcgagcttccccgagcgcgtc
ttctcggccatgccgatcgccacggcggcgaaacattcctcgcaaaacatcgcctttcac
gaggtcggccggcaggccgtgatggccgatcccgactggcgcaagggccgctatctcgag
gaaggggtcatccccaccaaaggcctcgccgtcgcccgcatggcggcgcatatcacctat
ctgtccgacgaggcgctgcagagcaaatttggccgcaagctacaggaccgcgacgcgccg
accttctccttcgacgccgaattccagatcgagaattatctgcgctatcagggctcgagc
ttcgtcgaccggttcgatccgaactcctatctttatgtgacccgagcttgcgactatttc
gacctggccgccgactacgacggatcgctggcgcgcgcctttcagggggtcaaggcgcgc
ttttgcgtcgtctcgttcaattccgactggctctatccgaccgccgcctcgcgcgccatc
gtgcacgccctgaacgccgggggcgcctcggtctccttcgtcgacatcgagaccgatcgc
ggccacgacgcctttctgctcgacctgccggagttcatcgccacctcgcagggctttctc
gattcggccgccaaggctcgcggcctgccgccggccgcgccttga

DBGET integrated database retrieval system