KEGG   Methylocella silvestris: Msil_1382Help
Entry
Msil_1382         CDS       T00802                                 

Definition
(GenBank) Argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
msl  Methylocella silvestris
Pathway
msl00220  Arginine biosynthesis
msl00250  Alanine, aspartate and glutamate metabolism
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01130  Biosynthesis of antibiotics
msl01230  Biosynthesis of amino acids
Module
msl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msil_1382
   00220 Arginine biosynthesis
    Msil_1382
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msl04147]
    Msil_1382
Enzymes [BR:msl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Msil_1382
Exosome [BR:msl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msil_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-ProteinID: ACK50347
UniProt: B8ESL2
Position
1493788..1495038
Genome map
AA seq 416 aa AA seqDB search
MPSKQSDIKKVVLAYSGGLDTSIILKWLETTYGCEVVTFTADLGQGEEIEPARQKAILLG
VKPENIFIEDLREEFVRDYVFPMFRANAQYEGLYLLGTSIARPLIAKKQIEIAKKTGADA
VAHGATGKGNDQVRFELSYYALDPDIKVIAPWREWDLTSRTALIAFAEQHQIPIAKDKRG
DAPFSVDANLLHASSEGKVLEDPAEEVPDYVYSRTVNPEDAPDKPTYIEIDFERGDPVAI
DGEALSPANLLTRLNELARVNGVGRLDLVENRFVGMKSRGMYETPGGTILYVAHRGIESI
TLDRGAAHLKDELAPKYSELIYNGFWFSPEREMLQALIDKSQEFVAGRVRVKLYKGSAVV
VGRSSPYSLYDQDLVTFEEGAVAYDHRDAAGFIKLNALRLRTLGKRARKIAAAQKA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccctccaaacaatcagacatcaaaaaagtcgttctcgcctattcgggaggtctcgac
acctcgatcatcctgaaatggctcgagacgacctatggctgcgaagtcgtgaccttcacc
gccgatctcggccagggcgaagagatcgagccggcgcgccagaaagccattctgctcggc
gtcaagccggaaaacatttttatcgaggatctgcgcgaagaattcgtgcgcgactatgtg
tttccgatgttccgcgccaacgcgcaatatgaggggctttacctgctcggcacctcgata
gcgcggccgctcatcgccaagaagcagatcgagatcgccaagaaaaccggcgccgacgcg
gtcgcccatggcgcgaccggcaagggcaatgaccaggtccggttcgaactctcctattat
gcgctggaccccgacatcaaggtgatcgcgccctggcgcgaatgggacctgacctcccgc
accgcgctgatcgccttcgccgaacagcaccagatcccgatcgccaaggacaagcgcggc
gacgcgcccttctcggtcgacgccaatctgctgcacgcctcctccgaaggcaaagtgctg
gaagacccggccgaggaagtgccggactatgtctattcgcgcacggtcaatccggaagac
gcgcccgacaagccgacctatatcgagatcgatttcgagcgcggcgatcccgtcgccatc
gacggcgaggcgctgtcgcctgcaaacttgctgacccggctgaacgaacttgcgcgcgtc
aacggcgtcgggcggctcgatcttgtcgagaaccgcttcgtcggcatgaagtcgcgcggc
atgtatgagacgcccggcggcacgatcctctatgtcgctcatcgcggcatcgaatcgatc
acgctcgatcgcggcgcagcgcatcttaaggacgagctcgcgccgaaatattccgagctc
atctacaatggcttctggttctcgcccgagcgcgaaatgctgcaggcgctgatcgacaag
agccaggaattcgtagcgggccgcgtgcgagtcaaactctacaagggctcggcggtggtc
gtcggccgctccagcccctactcgctctatgatcaggatctcgtgaccttcgaggagggc
gccgtcgcctatgatcaccgcgacgccgccggatttatcaagctgaacgcgttgcggctg
cgtacgctgggaaaacgggcgcgaaaaatcgccgccgcacaaaaggcttag

DBGET integrated database retrieval system