KEGG   Methylocella silvestris: Msil_1479Help
Entry
Msil_1479         CDS       T00802                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
msl  Methylocella silvestris
Pathway
msl00360  Phenylalanine metabolism
msl00362  Benzoate degradation
msl00621  Dioxin degradation
msl00622  Xylene degradation
msl01100  Metabolic pathways
msl01120  Microbial metabolism in diverse environments
msl01220  Degradation of aromatic compounds
Module
msl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Msil_1479
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Msil_1479
   00622 Xylene degradation
    Msil_1479
   00621 Dioxin degradation
    Msil_1479
Enzymes [BR:msl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Msil_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866 E1_UFD
Motif
Other DBs
NCBI-ProteinID: ACK50437
UniProt: B8ESV2
Position
1597917..1598957
Genome map
AA seq 346 aa AA seqDB search
MARINPNKLYVQDVTLRDGMHSVRHQYSLDAVRAIARALDRAHVDAIEISHGDGITGSTF
NYGFGAHDDTEWIAAVAGECKFSRITVLLLPGIGTVHDLKYACEAGARSVRVATHCTEAD
VSRQHIEAGRKLGMDTVGFLMMAHMAPVEKLVEQALLMESYGAECVYVTDSAGALLPKQY
AERVKAVRGALKPETEIGVHTHHNLTLGVANAVAGIEAGAVRVDASLAGMGAGAGNAPLE
ALIAVLDRMGIETGCDLHMLMDAADDLVRPLQDRPVRVDRESLSLGYAGVYSSFLRHAES
ASKLYGVDTRDILTELGKRRMVGGQEDMIVDVALDILKSHGAEAAQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcaatccgaacaagctatacgtccaggatgtcacgctgcgcgacggcatg
cattcggtgcgtcaccagtacagccttgacgcggtgcgcgccatcgcccgtgcgctcgac
cgcgcccacgtcgacgccatcgagatcagccacggcgacggcatcaccggctcgaccttt
aactacggcttcggcgcgcatgacgataccgaatggatcgcagcggtggccggcgaatgc
aagttctcgcgcatcactgtgctgctactgccgggcatcggcaccgtgcatgatctcaaa
tatgcctgtgaggccggcgcgcgtagcgtgcgcgtcgccacccattgcacggaagcggac
gtttcgcgccagcatatcgaggcgggccgcaagcttggcatggatacggtcggctttttg
atgatggcgcacatggcgccggtggagaagctggtcgaacaggcgctgctgatggaaagc
tatggcgccgaatgcgtctatgtgacggattcggctggcgcgctgctgccgaaacagtac
gccgaacgcgtaaaagcggtgcgcggcgcgctgaagcccgagacggaaatcggcgtgcac
acccaccacaatctgacccttggtgtcgcgaacgccgtggcgggaattgaggcaggcgcc
gttcgcgtcgacgcctcgctcgccggcatgggcgcgggcgccggcaacgcgccgctcgaa
gctctgatcgcggtgctcgaccggatgggaatcgagaccggctgcgacctgcacatgttg
atggacgcggcggacgatctcgtgcggcccctgcaggaccgtccggtgcgggtggaccgc
gagtcgctttcactcggctacgccggcgtctattcgagcttcctgcgccatgcggaaagc
gcctcgaaactctatggcgtcgatacgcgcgacatcctcaccgaactcggcaagcggcgc
atggtcggcggccaggaagacatgattgtcgacgtcgcgctggacattctcaaatcacac
ggggcggaggcggcccaatga

DBGET integrated database retrieval system