KEGG   Methylocella silvestris: Msil_2243
Entry
Msil_2243         CDS       T00802                                 

Definition
(GenBank) deoxyuridine 5'-triphosphate nucleotidohydrolase Dut
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
msl  Methylocella silvestris
Pathway
msl00240  Pyrimidine metabolism
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Msil_2243
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:msl03400]
    Msil_2243
Enzymes [BR:msl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     Msil_2243
DNA repair and recombination proteins [BR:msl03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Msil_2243
 Prokaryotic type
    Msil_2243
SSDB
Motif
Pfam: dUTPase
Other DBs
NCBI-ProteinID: ACK51177
UniProt: B8ET39
Position
2430502..2430984
AA seq 160 aa
MSEPLTIGIKRLPHGADLPLPAYQSAGAAGLDLLAAIAPGSKLTLEPGERRLVPTGLVLQ
IPPSHEGQLRPRSGLALKAGVTVLNAPGTIDSDYRGEVGVLLINFGAEPFEIARGERIAQ
LIIAPVTRAVLVETDGLEATARGAGGFGSTGAAAIGETRR
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagcgaaccgctgacgatcggcataaagcgcctgccgcatggagcggacctgccgctg
cccgcctatcagagcgcgggcgcggccggcctcgatcttctcgccgccattgcgccggga
tcgaaactgacgctggagcccggcgagcgccgcctcgtgccgaccggccttgtcctgcaa
attcccccctcgcatgagggtcagctgcggccgcgctcgggccttgccctgaaagccggc
gtcaccgtgctgaacgcgccgggcacgatcgattccgactaccgcggagaggtcggggtc
ctgctgatcaatttcggcgcggagccgttcgagatcgcgcgcggcgagcgcatcgcgcag
ctcatcatcgcgccggtgacgcgcgccgtgctggtcgagaccgacgggctggaggcgacc
gcgcgcggcgccggcggattcggctcgaccggggcggccgcgatcggggagacgcggcga
tga

DBGET integrated database retrieval system