KEGG   Methylocella silvestris: Msil_2353
Entry
Msil_2353         CDS       T00802                                 

Definition
(GenBank) type IV / VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
msl  Methylocella silvestris
Pathway
msl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:msl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Msil_2353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:msl02044]
    Msil_2353
Secretion system [BR:msl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Msil_2353
SSDB
Motif
Pfam: DotU OmpA DUF4040
Other DBs
NCBI-ProteinID: ACK51283
UniProt: B8EIG4
Position
complement(2560345..2561829)
AA seq 494 aa
MNEKDPPDSLGRRDNRTIIVPNPGGRRPEAARPSPAYAPPPSGAPYVPAQPGAAPVWPSH
PSHGAEASPGDEWIKGRAAAAQTPDRIVRDIPIDDLLVPNENPLLRAAGPLLLLLGRLRV
AQLQASPASLMGQVAEAVAFFDKEIRATGVPPQQAETAKYILCATADDIVQNIPTEDRHV
WTQYSMLSRFFGERIGGVRFFSELDKAKTDPLNNYDLLELIYDCLALGFQGVHRSSATGA
VSLQQIQRDLYELLRRVRPRVDRELSPHWRGQSLPRGVMRARIPFWAIASLAALCLFGLF
ITLRMLLTGAADVAAADLNGLIGRGDLKLVRHNFAPPPKPPEPPPGKLTQLQRIRLALAP
EIAAKKVDATQTATKIRIIVGDLVLFPSGQANVKPQFEPIAKRIAQTLEKEPGAITIVGH
TDNVKLQATSPFDSNWTLSMARAKAVAAVLKPGLSEPARIEVDGKADEQPIAPNDTPAGR
AQNRRVEIMLARSD
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaacgagaaggacccgccggacagcctcgggcggcgcgacaatcgtacgatcatcgtg
ccgaaccccggcgggcgaaggcccgaggcggcgcgcccttcgcctgcctatgcaccgcct
ccttcgggcgcgccctatgtcccggcgcagccgggcgcggcgcctgtttggccgtcacac
ccctctcatggcgcagaggcctcccccggcgacgaatggatcaagggacgcgcagcggcg
gcgcaaacgcccgatcggatcgtgcgcgatattccgatcgacgatcttcttgtccccaat
gaaaatccgctgctgcgcgcggcggggccattgctgctgctgcttggtcgtctgcgcgtc
gcgcagctgcaggcgtcgcccgcgagcctgatggggcaggtggcggaggccgtcgctttt
ttcgacaaggagattcgcgcgacgggcgtcccgccgcagcaggcggaaaccgcgaaatat
attctctgcgccaccgccgacgacatcgtccagaacatcccgaccgaggatcgccacgtc
tggacgcaatattcgatgctgagccgcttcttcggcgaacgcatcggcggcgttcgcttc
ttctccgagctcgataaagcgaagaccgatccgctcaataattacgatctgctcgaactc
atctatgattgcctcgcgctcggcttccagggcgtgcaccgcagttcggcgaccggcgcc
gtcagcctgcagcaaatccagcgcgatctttacgagctcttgcgccgggtccgtccgcgc
gtcgaccgggagctgtcgccgcattggcgcggccagagcctgccgcgcggcgtcatgcgc
gcacgcattcccttctgggcgatcgccagcctcgccgcgctctgcctgttcggcctcttc
attaccttgcgcatgctgctaacgggcgccgccgatgttgcagcagcggacctcaacggc
ctgatcggccgcggcgacctgaagctggtgaggcataattttgccccgccgccgaagccg
cccgagccgccgcccggcaaactgacccagctccagcgcatcaggctcgcgctcgctccc
gaaatcgcagcgaagaaggtcgacgccacccagaccgcgacgaagatcaggatcattgtc
ggcgatctcgtgctgtttccgtcagggcaggccaatgtgaagccgcagttcgagccgatc
gccaagcgcatcgcgcagactttggaaaaggagccgggcgcgatcacgatcgtcggccat
accgacaatgtgaagctgcaggcgacgtcgcccttcgactcgaactggactttgtcgatg
gcgcgcgccaaggcggtcgccgccgtgctgaagccgggccttagcgaaccggcccgcatc
gaagtcgacggaaaggcggacgagcagccgatcgcgccgaacgatacgccggcggggcgg
gcgcagaaccgccgcgtcgaaatcatgctcgcccgatcggactga

DBGET integrated database retrieval system