KEGG   Methylocella silvestris: Msil_2360
Entry
Msil_2360         CDS       T00802                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
msl  Methylocella silvestris
Brite
KEGG Orthology (KO) [BR:msl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:msl02044]
    Msil_2360
Secretion system [BR:msl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Msil_2360
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACK51290
UniProt: B8EIH1
Position
2570154..2570705
AA seq 183 aa
MAGDSGQKFIGRNRPPRVQIAYEDPYDAERKIELPFVMGVLSDLSGPNPGVEKPDVADRG
FVDIDMDNFDKRMGAIEPGTSFTVPDRLGDDPDAAKLSVSLRFKKMEDFGPAAVARQVPA
LAKLLEARDQLANLLRYMDGKVDAETRLRKLLSDPELMAALKSRIGATKDAEAETAKTAD
GDA
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcaggtgacagtggacagaaattcattggacgcaaccgtccgccacgtgtgcagatt
gcttatgaggatccctatgacgcggagcgaaagatagagctgcccttcgtcatgggcgtg
ctctccgacctctccggcccgaaccccggcgtcgagaagccggacgtcgccgatcggggc
ttcgtcgatatcgacatggataatttcgacaagcgcatgggcgcgatcgagcctggaaca
tccttcaccgtgccggaccggcttggcgacgacccggacgccgccaaattgtcggtcagc
ctgcgcttcaagaagatggaagacttcggcccggcggcggtcgcccggcaggtgccggcg
ctcgccaaactgctcgaggcgcgcgaccagctggcaaatctgttgcgctatatggacggc
aaggtcgacgccgaaacgcggctgcgtaaattgctgagcgatcccgaactgatggcggcg
ctgaaaagccgcatcggcgcgacgaaggacgctgaagccgaaaccgccaagaccgccgac
ggcgacgcttga

DBGET integrated database retrieval system