KEGG   Methylocella silvestris: Msil_2363Help
Entry
Msil_2363         CDS       T00802                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11897  type VI secretion system protein ImpF
Organism
msl  Methylocella silvestris
Brite
KEGG Orthology (KO) [BR:msl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:msl02044]
    Msil_2363
Secretion system [BR:msl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Msil_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ACK51293
UniProt: B8EIH4
Position
2572969..2573517
Genome map
AA seq 182 aa AA seqDB search
MSVPTRKNRLSPPFMHAFRSAFEQKDSRQKQDLRDAAGDRIIAPRRAAVRATISEPNLRR
EVARDLEALVNAVAFESTEDLSDFDGVRKSILNYGLPDLIHRTIDEAGVNLIEDEIANAL
RRYEPRLVANTIKVSRDDNLDKDELKVRFLVRADLICAPVNVPVEFIADVEIDSGDVVVK
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttccgacacgaaaaaatcgtctcagtccgcccttcatgcacgccttccgcagc
gccttcgagcagaaggactcgcgccagaaacaggatctgcgcgacgccgccggcgaccgc
atcatcgcgccgcgccgcgccgccgtgcgcgcgacgatcagcgaacccaatctgcgccgc
gaagtcgcgcgcgatcttgaggcgctcgtcaacgccgtggcgttcgaatcgaccgaggat
ctgtccgactttgacggcgtccgcaaatcgatcctcaattacggcctgcccgatctcatt
caccgcaccatcgacgaggccggcgtcaacctcattgaagatgaaatcgccaacgccttg
cggcgctatgagccgcggcttgtcgccaacaccatcaaagtctcgcgcgacgacaacctc
gacaaggatgagctcaaagtccgctttctcgtgcgggccgatctcatctgcgcgccggtc
aatgtgccggttgaattcatcgccgatgtcgagatcgacagcggcgacgttgttgtgaag
aaagcctga

DBGET integrated database retrieval system