KEGG   Methylocella silvestris: Msil_2710Help
Entry
Msil_2710         CDS       T00802                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
msl  Methylocella silvestris
Pathway
msl00521  Streptomycin biosynthesis
msl00523  Polyketide sugar unit biosynthesis
msl01130  Biosynthesis of antibiotics
Module
msl_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Msil_2710
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msil_2710
Enzymes [BR:msl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Msil_2710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACK51632
UniProt: B8ERT4
Position
2969353..2969925
Genome map
AA seq 190 aa AA seqDB search
MDVKTTDLPGVLVLKPRRFADQRGYFVETYNRRTFAKAGVDAQFVQDNQSFSAKAGTIRG
LHFQLPPAAQAKLVRAVRGAIFDVAVDLRAGSPTFGRWIGETLTAGGGEQLLIPRGFAHA
FCTLEDDVEVAYKVDDFYAPTCDSGLIWNDPDLKIEWPVEASAAVLSDKDAKLGRFADFV
SPFRFEAGAP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaagacgacagatttgcccggcgtcctggttttgaaaccgcgccggttcgct
gaccagcgcggctatttcgttgaaacctacaatcggcggacattcgccaaggcaggcgtc
gacgcgcaattcgtccaggataaccagtccttttcagccaaggccggaacgatccgcggc
ctgcatttccagctgccgccggcggctcaggccaagcttgtcagagcggtgcgcggcgcg
atcttcgatgtggcggtcgatctgcgcgccggctcgccgacattcggccgctggatcgga
gagacgctgaccgctggcggcggagaacaattgctgattccgcgcggcttcgctcatgcc
ttctgcaccctcgaggacgatgtggaagtcgcctataaggtcgatgatttctatgccccg
acatgcgacagcggattgatctggaacgatcccgatctcaagatcgaatggcctgtcgag
gccagcgccgccgtcctttcggacaaggacgccaagctcggacgtttcgcggatttcgtt
tctccatttcgtttcgaggcgggcgcgccatga

DBGET integrated database retrieval system