KEGG   Methylocella silvestris: Msil_2798Help
Entry
Msil_2798         CDS       T00802                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
msl  Methylocella silvestris
Pathway
msl00270  Cysteine and methionine metabolism
msl00480  Glutathione metabolism
msl01100  Metabolic pathways
Module
msl_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Msil_2798
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Msil_2798
Enzymes [BR:msl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Msil_2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACK51717
UniProt: B8ET75
Position
3071812..3072834
Genome map
AA seq 340 aa AA seqDB search
MPLTVAVQMDPIEKVNIAGDTTFALMLEAQARGHRLIYYTPDRLSFSDGRVLALACEIVV
RDIAGDHFTLGAEKPVDLAGVDVVLLRQDPPFDLAYITSTHLLEMLPPHVLVVNDPASVR
NAPEKLFVMKFPELMPKTLISRDKKTIEEFREANGEVVMKPLYGHGGSAVFKVARKDPNF
GSLFDLFATTFREPWVVQQFLPAVSRGDKRIILIDGVALGAVNRVPAENDIRSNMVRGGA
AAATEFTPRERDICAAIGPELKRLGLIIVGIDVIDGNLTEINVTSPTGVRAIRRVGGPDL
AIAAWDAIEARRNEKINIVSSHVGGDGARGSGEDRAASRA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttaccgtcgccgtccagatggacccgatcgaaaaggtcaatatcgccggcgac
acgaccttcgccctgatgctggaggcgcaagcgcgcggccatcgcctgatttattacacg
ccggacaggctgtccttctcggacggacgcgtcctcgcgctggcctgcgaaattgtggtc
agggatattgccggggaccatttcacgcttggcgcggaaaagcctgtcgatcttgccggc
gtcgacgtggtgctgctgcggcaggatccgccgttcgatctcgcctatatcacctcgact
catctcctcgaaatgctgccgccgcatgtcctcgtcgtcaatgatccggcgagcgtgagg
aacgcccctgaaaagctgttcgtcatgaaattccccgaattgatgccgaaaacgctgatc
tcgcgcgacaagaaaaccatcgaggagttccgcgaggcgaatggcgaggtggtgatgaag
ccgctttacgggcatggcgggtccgccgtcttcaaggtcgcgcgaaaggatccgaatttc
ggctcgctgttcgatctgttcgcaacgaccttccgcgagccctgggtcgtgcagcagttc
cttcccgccgtgagccgcggcgacaagcgtatcatcctgatcgatggggtcgcgcttggc
gccgtcaatcgcgtgccggctgaaaacgacatccgctccaatatggtgcgcggcggcgcc
gcggcggcgacggaattcacgccccgcgagcgcgacatctgcgcggcgatcgggccggaa
ctcaaacggcttggcctgattatcgttggaatcgatgttatcgacggaaatctgaccgaa
attaatgtcacctcgccaaccggcgtccgggcgatcaggcgcgtcggcgggccggatctc
gcgattgcggcatgggacgcgatcgaggcgagacggaacgaaaaaatcaatatagtctcc
tcccatgtgggcggcgacggcgcgcggggctccggcgaagatagggccgcttctagagca
tga

DBGET integrated database retrieval system