KEGG   Methylocella silvestris: Msil_2996Help
Entry
Msil_2996         CDS       T00802                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msl  Methylocella silvestris
Pathway
msl00071  Fatty acid degradation
msl00072  Synthesis and degradation of ketone bodies
msl00280  Valine, leucine and isoleucine degradation
msl00310  Lysine degradation
msl00362  Benzoate degradation
msl00380  Tryptophan metabolism
msl00620  Pyruvate metabolism
msl00630  Glyoxylate and dicarboxylate metabolism
msl00640  Propanoate metabolism
msl00650  Butanoate metabolism
msl00900  Terpenoid backbone biosynthesis
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01120  Microbial metabolism in diverse environments
msl01130  Biosynthesis of antibiotics
msl01200  Carbon metabolism
msl01212  Fatty acid metabolism
msl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Msil_2996
   00630 Glyoxylate and dicarboxylate metabolism
    Msil_2996
   00640 Propanoate metabolism
    Msil_2996
   00650 Butanoate metabolism
    Msil_2996
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Msil_2996
   00072 Synthesis and degradation of ketone bodies
    Msil_2996
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Msil_2996
   00310 Lysine degradation
    Msil_2996
   00380 Tryptophan metabolism
    Msil_2996
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Msil_2996
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Msil_2996
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Msil_2996
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msl04147]
    Msil_2996
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Msil_2996
Exosome [BR:msl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msil_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACK51907
UniProt: B8EIU0
Position
3308044..3309216
Genome map
AA seq 390 aa AA seqDB search
MSDIVIVSAARTAVGAFNGGFAAVPAHELGAAAIKGALERAGVEGGEVDEVILGQVLTAG
QGQNPARQASIKAGVPQERTAFNINQLCGSGLRAVALGLQQIASGDANIIVAGGQESMSQ
AQHSAYLRSGVKMGDLKFADTMITDGLTDAFNHYHMGQTAENIAAKWQLTRDEQDRFAVA
SQNKAEAAQKGGKFGDEIIPYTISTKKGDIVVDKDEFIRMGATLEALAKLRPAFNKDGSV
TAGNASGINDGAAAVVLMTSAEAAKRGLEPLGRIASWATAGVDPAIMGTGPIPASRRALE
KAGWKVGDLDLIEANEAFAAQSLAVCKDLALDPDKVNVNGGAIAIGHPIGASGARVLVTL
LYELRRRNGKKGLATLCIGGGMGIALTIER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatattgttatcgtgagcgcggcgcgcacggccgtcggcgcattcaacggcggc
tttgccgcggtcccggcccatgagcttggcgccgcggccatcaagggcgcgttggagcgg
gccggcgtcgaaggcggcgaagtcgacgaagtcattctcggtcaggtgctgacggcgggc
cagggccagaacccggcgcgtcaggcgtcgatcaaagccggcgtgccgcaggaacggacc
gcctttaacatcaatcagttgtgcggctcgggactgcgcgctgtcgcgcttggcctgcag
cagatcgccagcggagacgccaatatcatcgtcgcgggtggtcaggaaagcatgtcgcag
gcgcagcacagcgcctatttgcgctcgggcgtcaagatgggcgacctcaaattcgccgac
accatgatcaccgacgggctgaccgacgccttcaaccactaccacatggggcagacggcc
gagaatatcgcggccaaatggcagctgacccgcgacgagcaggatcgtttcgccgtcgcc
tcgcagaataaggccgaggcggcgcagaagggcggcaagttcggcgacgaaatcatcccc
tacacgatcagcaccaaaaagggcgatatcgtcgtcgacaaggatgagttcatccgcatg
ggcgcgacgcttgaggcgctcgccaagctgcgcccggccttcaataaggacggcagcgtg
accgccggcaacgcctccggcatcaatgacggcgcggcggcggtggtgctgatgacctcc
gccgaggcggccaagcgcggccttgagccgctgggccgcatcgcctcctgggcgacggcc
ggcgtcgatccggcgatcatgggcaccggccccattccggcttcgcgccgggcgctggaa
aaggccggctggaaggtcggcgatcttgatctgatcgaggcgaacgaagccttcgccgcg
cagtcgctcgcggtctgcaaggatctcgctctcgatcccgacaaggtcaatgtcaatggc
ggcgcgattgcgatcggccatccgatcggcgcttcgggagcccgcgtcctcgtcaccctt
ctgtatgaattgcgccggcgcaacggcaagaagggcctcgccacgctttgcattggcggc
ggcatgggcatcgcgctcacgatcgaacgctag

DBGET integrated database retrieval system