KEGG   Methylocella silvestris: Msil_3000Help
Entry
Msil_3000         CDS       T00802                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
msl  Methylocella silvestris
Pathway
msl00020  Citrate cycle (TCA cycle)
msl00620  Pyruvate metabolism
msl00650  Butanoate metabolism
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01120  Microbial metabolism in diverse environments
msl01130  Biosynthesis of antibiotics
msl01200  Carbon metabolism
Module
msl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msil_3000
   00620 Pyruvate metabolism
    Msil_3000
   00650 Butanoate metabolism
    Msil_3000
Enzymes [BR:msl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Msil_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: ACK51911
UniProt: B8EIU4
Position
3314359..3315876
Genome map
AA seq 505 aa AA seqDB search
MSGFGRIECQKLRSKMMSAEAAASLIPSGSVIGMSGFTGSGYPKAVPTALAERAAAARGA
GDPFRVSVWTGASTGPELDGALARADAIEFRLPFNSDPVLREKINRGEMDYMDMHLSQVA
PMAWQGFLGPLDLAIIEVSGVRPDGSLIPSSSIGNNKTWLDRAQKIILEVNAWQNEALDG
MHDVYYGTMLPPHRVPIPLLRPDDRIGEPYFRCDPDKVVAIVETSAPDRNLPFAPPDDAA
RAIAGHLLEFFRHEVARGRLPPSLLPIQSGVGNVANAVLTGLLESPFEDLTSFTEVIQDG
MLDLLAAGKLRFASATAFSLSPDAAAFLNANLAKFRDKMLLRPQEISNHPELVRRLGCIA
MNGLIEADIYGSVNSTHVMGSRIQNGIGGSGDFARNAYVSIFMTQSTAKGGAISSIVPMA
SHVDHIPQDVQILVTEQGLADLRGLSPRQRARVIIQNCAHPDYRPGLFDYFARAGESSYG
RHAPCLLDEALSWHQRFIKTGTMRA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgggtttgggcgaattgagtgtcaaaagctgcgttcgaaaatgatgagcgctgag
gccgcggcgtctttgatcccctccggatcggtgatcggcatgagcggctttaccggctct
ggctatcccaaggccgttccgaccgctctggccgagcgggccgccgccgcccggggtgct
ggcgatccgtttcgcgtgagcgtctggactggcgcctcgacggggccggaactggacggc
gccctcgccagagctgacgcgatcgaattccgcctgccgttcaactccgatccggtcctg
cgcgaaaaaataaaccgcggcgagatggactatatggacatgcaccttagtcaggtcgcg
cccatggcctggcagggttttctcggcccgctcgatctcgccattatcgaggtttcgggc
gtgcgcccggatggttcgctgattccgtcctcctccatcggcaacaacaagacatggctc
gaccgggcgcagaagatcattctcgaggtcaacgcctggcagaatgaagcgctcgacggg
atgcatgacgtctattatggaacgatgctgccgccgcatcgcgtccccattccgcttttg
cgtccagacgatcgcatcggcgagccctatttccgctgcgatcccgacaaagtcgtcgcc
atcgtcgaaaccagcgcgccggatcgcaatcttccctttgcgccgcccgacgacgcggcc
cgcgcgatcgccggccatctgctcgaattcttccggcacgaagtcgcgcgggggcgtctg
ccgccgtccttgctgccgatccagtccggcgtcggcaatgtcgccaacgccgtgctgaca
ggcttgctcgagagcccattcgaggatttgacctcttttacggaagtgatccaggacggc
atgctggacctccttgccgctggaaagcttcgctttgcctcagcgacggctttctcgctg
agcccggacgcagcggctttcctcaacgccaatctggcgaagttccgcgacaagatgctg
ctgcgcccgcaggaaatcagcaaccatcccgagctggtccgccgcctcggctgtatcgcg
atgaatgggttgatcgaggcggatatctacggctcggtcaattcgacccatgtcatggga
tcgcggatccagaatggcatcggcgggtccggcgatttcgcgcgcaacgcctatgtatcg
atcttcatgacgcaatcgacggcgaaaggcggcgcgatctcctcgatcgtgccgatggcg
agccatgtcgatcatatcccgcaggatgtgcagatcctggtcacggagcaggggttggcc
gatctgcgcggtctttcgccgaggcagcgcgcccgcgtcatcattcagaactgcgcccat
cccgactaccggccgggacttttcgactattttgcccgggccggggagtcctcctacggg
cgacatgctccctgtttgcttgatgaggcgctgtcctggcatcagcgcttcatcaaaacc
gggacgatgcgcgcatga

DBGET integrated database retrieval system