KEGG   Methylocella silvestris: Msil_3544Help
Entry
Msil_3544         CDS       T00802                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
msl  Methylocella silvestris
Pathway
msl00670  One carbon pool by folate
msl01100  Metabolic pathways
msl01120  Microbial metabolism in diverse environments
msl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Msil_3544
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Msil_3544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACK52433
UniProt: B8ETT1
Position
3893629..3894549
Genome map
AA seq 306 aa AA seqDB search
MSEHPSCELPRASRTHCPDIRVSFEFFPPKTVAMEALLWESINRLAPLGPSFMSVTYGAG
GSTRERTHQTVARLAKEAVVRPAAHLTCVGASMKEIDGIVQGYWDAGVRHIVALRGDPPD
GLGATFEPHPQGYKNSCALVAGIKRIGDFEISVSAYPERHPESLSLDADIDFLRAKVDAG
ASRAITQFFFENEIYLRYLDRLRAAGVDIPIVPGIMPMQNFKQTAGFAKKAGASVPQWLA
DRFEGLDDDPQTRRLVAATVAAEQVLDLVDHGVRDFHFYTNNRADLVYAICHLLGLRPKP
EQKEAA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacatccaagctgtgaattgccgcgcgcgagccgcacgcattgccccgatatc
cgcgtctcgtttgagtttttcccgccgaagacggtcgccatggaggcgctgctctgggaa
tcgatcaatcgccttgccccgctcgggccgagctttatgtcggtgacctatggcgccggc
ggatcgacccgcgagcgcacccatcagactgtcgcgcgtctcgccaaggaagcggttgtg
cggcccgccgcgcacctcacctgcgtcggcgcctcgatgaaagagatcgacggcatcgtg
caaggctattgggacgccggcgttcgccatatcgtcgccttgcgcggcgatccgccggac
gggcttggggcgaccttcgagccgcatccgcagggctataagaattcctgcgcgctcgtc
gccggcatcaagcgcatcggcgatttcgagatttccgtctcggcctatccggagcgccat
ccggaaagcctgtcgcttgacgccgacatcgacttcctgcgcgcgaaggtcgatgccggc
gcgagccgggcaatcacccagttcttcttcgagaacgaaatctatctgcgctatctcgac
cggctgcgcgcggcgggcgtcgatattccgatcgtgccgggcatcatgccgatgcaaaat
ttcaagcagaccgcgggcttcgccaagaaggctggcgccagcgtgccgcaatggctcgcc
gaccgcttcgagggattggatgacgatcctcagacaaggcggctcgtcgccgccaccgtc
gcggcggagcaggtgctcgatcttgtcgatcacggcgtgcgggactttcatttctacacc
aacaatcgcgccgatctcgtctacgccatttgccatctcctcgggctgcggccgaaacct
gaacaaaaagaggccgcctga

DBGET integrated database retrieval system