KEGG   Methylocella silvestris: Msil_3835Help
Entry
Msil_3835         CDS       T00802                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
msl  Methylocella silvestris
Pathway
msl00900  Terpenoid backbone biosynthesis
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Msil_3835
Enzymes [BR:msl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Msil_3835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-ProteinID: ACK52717
UniProt: B8EMN8
Position
4197935..4199173
Genome map
AA seq 412 aa AA seqDB search
MKKVVQLRPSRSGEASSPDADSRRVVLLGATGSIGRSTVEIINGANGAFSVAAVAGGSDA
KALAAVAIELGAEFAALADPSGYADLKAALSGTAIEAAAGPEAVIEAALRPADIVVGAIA
GAAGVAPTFAALAAGRIIALANKECLVCAGPAFMRQAAASGTRLLPVDSEHNAIFQAMGD
AELSSVEMITLTASGGPFRTWSVEAIAAATPEQALAHPNWSMGPKVTIDSAGLMNKGLEV
IEAHYLFGIETARLDVLVHAQSVVHGLVAFSDGSVSAGLAAPDMKVPIAHCLSHPRRLVT
KARRLDLAAIGQLTFERPDFNRFPALRVALDALRAGRGLPTVLNAANEIAVEAFLKRRIS
FHEIAKIVEQACEAALSDGVAREPETIDEALAIDFAVRERTRARLPGTAAAS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtcgttcaactgcggccctcccgctccggcgaggcgagttcgccggacgcc
gattcgcgccgcgtcgtgctgctcggcgcgaccggctccatcggccgctcgaccgtcgag
atcatcaacggcgccaacggcgccttcagcgtggccgccgtcgccggcggcagcgacgcc
aaggcgctcgccgccgtcgccatcgagcttggcgcggaattcgccgcccttgcggatccg
tccggctatgcggatttgaaagcggcgctgtctggaaccgcgatcgaggcggcggccggt
cccgaggcggtgatcgaagcggcgctgcggccggccgacatcgttgtcggcgccatcgcc
ggcgccgccggcgtcgcgccgaccttcgccgcgctggccgccgggcgcatcatcgcgctc
gcgaataaggaatgcctcgtctgcgccgggccggccttcatgcgtcaggcggccgcgtcg
ggaacccggcttttgccggtcgacagcgagcacaacgccatttttcaggcgatgggcgac
gccgaattgtcgtccgtcgagatgatcaccctgacggcctccggcggaccattccgaacc
tggagcgtcgaggccatcgccgccgcgacgccggagcaggcgctcgcccatccaaactgg
tcgatgggaccgaaagtcacgatcgattcggccggcctgatgaacaaggggctcgaagtc
atcgaggcgcattatctgttcgggatcgagacggcgcggctcgacgtgctggttcacgcg
caatcggtggtgcacggcctcgtcgccttctcagacggatcggtctcggccggactcgcc
gcgcccgacatgaaggtgccgatcgcccattgcctgtcgcatccgcggcgtctcgttacc
aaggcgcgccggctcgatctcgcggcgatcggccagctcaccttcgagcgtccggatttt
aaccgctttccggccctgcgcgtcgccctcgacgccttgcgcgccggccgcggtcttcct
actgtattgaacgccgccaatgagattgccgtggaggcgttcctgaagcggcgcatttcg
ttccacgagatcgccaaaatcgtcgagcaggcttgcgaggcggcgctgtccgatggcgtc
gcgcgcgagccggagacgatcgacgaggcgctcgccattgatttcgccgtgcgcgaacgc
acgcgcgcccgtttgccggggaccgcggcggcgtcataa

DBGET integrated database retrieval system