KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_0026
Entry
MSMEG_0026        CDS       T00434                                 

Definition
(GenBank) putative membrane protein
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB
Motif
Pfam: CrgA
Other DBs
NCBI-ProteinID: ABK73698
UniProt: A0QNF8
Position
complement(46417..46701)
AA seq 94 aa
MPKSKVRKKNDFTSRPVSRTPVKVKAGPSSVWFVALFIGLMLFGLIWLLVFQLAATNPID
TPSFLQWMADLGPWNYAIAFAFMITGLLLTMRWR
NT seq 285 nt   +upstreamnt  +downstreamnt
atgcccaagtccaaagtccgcaaaaagaacgacttcacctccaggccggtgagccggacc
ccggtgaaggtgaaggccggaccgtccagtgtctggttcgtcgctctgttcatcggcctc
atgctgttcggtctcatctggctactggtgttccagctggcggcaaccaacccgatcgac
accccgtcgttcctccagtggatggcggatctcggtccgtggaactacgcgatcgccttt
gctttcatgatcaccggtctgttgctcaccatgcgctggcgctga

DBGET integrated database retrieval system